(data stored in ACNUC7421 zone)

EMBL: CP000948.YBBJ

CP000948.YBBJ        Location/Qualifiers
FT   CDS_pept        complement(452956..453411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbJ"
FT                   /locus_tag="ECDH10B_0445"
FT                   /product="conserved inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01615"
FT                   /protein_id="ACB01615.1"
FT                   /translation="MELMVVHPHIFWLSLGGLLLAAEMLGGNGYLLWSGVAAVITGLVV
FT                   WLVPLGWEWQGVMFAILTLLAAWLWWKWLSRRVREQKHSDSHLNQRGQQLIGRRFVLES
FT                   PLVNGRGHMRVGDSSWPVSASEDLGAGTHVEVIAIEGITLHIRAVSS"
     atggagttaa tggtcgttca tccacatatt ttctggctca gtctcggcgg tttgctgctg        60
     gcagccgaga tgctgggcgg aaatggttat ttgttgtgga gcggcgtggc agcggtgatt       120
     accggcctgg tggtctggct ggtgccgctg ggttgggagt ggcaaggggt aatgtttgcc       180
     atcctgacgc tgctcgccgc ctggctgtgg tggaaatggt tgtcgcggcg ggtgcgcgaa       240
     caaaagcaca gcgatagtca tttaaaccag cgcgggcagc agctgattgg ccgacgtttt       300
     gtgctggaat ctccgctggt caacgggcgc ggtcatatgc gcgtcggtga cagttcatgg       360
     cctgtcagcg ccagcgagga tctcggtgca ggtacgcatg ttgaagtcat tgcgatagaa       420
     gggataaccc tacatatccg agccgtctcg tcttaa                                 456
//

If you have problems or comments...

PBIL Back to PBIL home page