(data stored in ACNUC7421 zone)

EMBL: CP000948.YBBL

CP000948.YBBL        Location/Qualifiers
FT   CDS_pept        454474..455151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbL"
FT                   /locus_tag="ECDH10B_0447"
FT                   /product="predicted transporter subunit: ATP-binding
FT                   component of ABC superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01617"
FT                   /protein_id="ACB01617.1"
FT                   /translation="MQENSPLLQLQNVGYLAGDAKILNNINFSLRAGEFKLITGPSGCG
FT                   KSTLLKIVASLISPTSGTLLFEGEDVSTLKPEIYRQQVSYCAQTPTLFGDTVYDNLIFP
FT                   WQIRNRQPDPAIFLDFLERFALPDSILTKNIAELSGGEKQRISLIRNLQFMPKVLLLDE
FT                   ITSALDESNKHNVNEMIHRYVREQNIAVLWVTHDKDEINHADKVITLQPHAGEMQEARY
FT                   ELA"
     atgcaggaaa atagtccttt gcttcagcta caaaacgtag gatatctggc gggtgatgcg        60
     aagattctta ataacatcaa tttttcgctg cgtgctggcg aatttaagtt aattaccggt       120
     ccttctggtt gtggcaaaag tacgctgcta aaaatagttg cttcattgat cagcccaacc       180
     agcggaacgt tactgtttga aggtgaggat gtcagcacac taaagccaga aatctaccgc       240
     caacaagtct cttactgcgc ccagacaccg acgctgtttg gcgatacggt atacgataat       300
     ctgatctttc cctggcagat ccgtaaccgg cagcctgacc cagccatttt tctcgatttt       360
     ctcgaacgct tcgccttgcc ggacagcatt ttgacgaaga atatcgccga gctatctggt       420
     ggtgaaaaac aacgcatctc attgattcgt aacctgcaat ttatgccgaa ggttttattg       480
     ctggatgaaa taaccagtgc gctggatgaa agtaataaac ataacgtcaa tgagatgatc       540
     catcgttatg tgcgcgagca aaatattgcc gtgctgtggg tgacacacga taaagacgaa       600
     attaatcatg cggataaagt gattacactg caaccgcatg ccggagaaat gcaggaagca       660
     cgctatgaac tcgcataa                                                     678
//

If you have problems or comments...

PBIL Back to PBIL home page