(data stored in ACNUC7421 zone)

EMBL: CP000948.YBBM

CP000948.YBBM        Location/Qualifiers
FT   CDS_pept        455138..455917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbM"
FT                   /locus_tag="ECDH10B_0448"
FT                   /product="predicted inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01618"
FT                   /protein_id="ACB01618.1"
FT                   /translation="MNSHNITNESLALALMLVVVAILISHKEKLALEKDILWSVGRAII
FT                   QLIIVGYVLKYIFSVDDASLTLLMVLFICFNAAWNAQKRSKYIAKAFISSFIAITVGAG
FT                   ITLAVLILSGSIEFIPMQVIPIAGMIAGNAMVAVGLCYNNLGQRVISEQQQIQEKLSLG
FT                   ATPKQASAILIRDSIRAALIPTVDSAKTVGLVSLPGMMSGLIFAGIDPVKAIKYQIMVT
FT                   FMLLSTASLSTIIACYLTYRKFYNSRHQLVVTQLKKK"
     atgaactcgc ataatattac taacgaatca ttagcactgg cattaatgct ggtggtggtg        60
     gcaatcttaa ttagccataa agaaaaactg gcgctggaga aagatattct ctggagcgtc       120
     gggcgagcga taattcagct gattattgtc ggctatgtgc tgaagtatat tttcagcgtg       180
     gatgatgcca gcctgacatt attgatggtg ttatttatct gctttaatgc ggcgtggaac       240
     gcgcaaaaac gcagtaaata tattgctaaa gcttttatct catcgtttat tgccattacg       300
     gtcggggcgg gaattaccct ggcggtgctg attctctcag ggtcgattga atttatcccg       360
     atgcaggtga tccctatcgc cgggatgatt gccggtaacg ccatggtagc ggtggggttg       420
     tgttacaaca atttagggca acgggtcatt agcgaacagc aacagattca ggagaaactg       480
     agtcttggtg cgacgccgaa gcaggcttca gcgatattga ttcgcgacag tattcgcgcg       540
     gctttaattc cgacggtcga ttcagcaaaa acggttggct tagtgagttt accaggaatg       600
     atgtccgggc tgatatttgc cgggattgat ccggtgaagg cgattaaata tcagattatg       660
     gtgaccttta tgctgctctc aaccgccagc ttgtcgacca ttattgcctg ctatttaacc       720
     tatcgtaagt tttataattc gcgccaccag ttggtggtga cgcaattgaa gaagaaatga       780
//

If you have problems or comments...

PBIL Back to PBIL home page