(data stored in ACNUC7421 zone)

EMBL: CP000948.YBBP

CP000948.YBBP        Location/Qualifiers
FT   CDS_pept        458971..461385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbP"
FT                   /locus_tag="ECDH10B_0453"
FT                   /product="predicted inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01623"
FT                   /protein_id="ACB01623.1"
FT                   /translation="MIARWFWREWRSPSLLIVWLALSLAVACVLALGNISDRMEKGLSQ
FT                   QSREFMAGDRALRSSREVPQAWLEEAQKRGLKVGKQLTFATMTFAGDTPQLANVKAVDD
FT                   IYPMYGDLQTNPPGLKPQAGSVLLAPRLMALLNLKTGDTIDVGDATLRIAGEVIQEPDS
FT                   GFNPFQMAPRLMMNLADVDKTGAVQPGSRVTWRYKFGGNENQLDGYEKWLLPQLKPEQR
FT                   WYGLEQDEGALGRSMERSQQFLLLSALLTLLLAVAAVAVAMNHYCRSRYDLVAILKTLG
FT                   AGRAQLRKLIVGQWLMVLTLSAVTGGAIGLLFENVLMVLLKPVLPAALPPASLWPWLWA
FT                   LGTMTVISLLVGLRPYRLLLATQPLRVLRNDVVANVWPLKFYLPIVSVVVVLLLAGLMG
FT                   GSMLLWAVLAGAVVLALLCGVLGWMLLNVLRRMTLKSLPLRLAVSRLLRQPWSTLSQLS
FT                   AFSLSFMLLALLLVLRGDLLDRWQQQLPPESPNYFLINIATEQVAPLKAFLAEHQIVPE
FT                   SFYPVVRARLTAINDKPTEGNEDEALNRELNLTWQNTRPDHNPIVAGNWPPKADEVSME
FT                   EGLAKRLNVALGDTVTFMGDTQEFRAKVTSLRKVDWESLRPNFYFIFPEGALDGQPQSW
FT                   LTSFRWENGNGMLTQLNRQFPTISLLDIGAILKQVGQVLEQVSRALEVMVVLVTACGML
FT                   LLLAQVQVGMRQRHQELVVWRTLGAGKKLLRTTLWCEFAMLGFVSGLVAAIGAETALAV
FT                   LQAKVFDFPWEPDWRLWIVLPCSGALLLSLFGGWLGARLVKGKALFRQFAG"
     atgattgcac gttggttctg gcgcgaatgg cgttcgccgt cgctattaat tgtctggctg        60
     gcgctaagcc tggcggtggc ctgcgtgctg gcgctgggca atatcagcga tcgcatggag       120
     aagggcttaa gccagcaaag ccgtgagttt atggcgggcg atcgggcgtt gcgcagttca       180
     cgcgaagtgc cgcaagcgtg gctggaggaa gcgcaaaagc gcggcctgaa agtcggcaag       240
     cagctgactt tcgccacaat gacctttgca ggcgacacac cgcagctggc gaacgtcaaa       300
     gcggtggatg atatctaccc gatgtatggc gatctgcaaa ctaatccccc tggcctgaaa       360
     ccgcaggcgg gcagcgtatt gctggcccca cgcctgatgg cactgcttaa cctgaaaacg       420
     ggcgacacca ttgacgtggg cgatgccacc ttgcggattg ccggagaagt gattcaggaa       480
     ccggattccg gttttaaccc cttccagatg gctccgcgtc tgatgatgaa tctggcggat       540
     gtcgataaaa ccggagccgt gcagccgggg agtcgggtca cctggcgtta taaattcggc       600
     ggcaacgaga accagctcga cggctatgag aaatggttgt tacctcagct taaacccgaa       660
     caacgctggt acggtctgga acaggacgaa ggcgcgctgg ggcgatcgat ggaacgctcg       720
     caacagttcc tgctgctttc ggcgcttctg accttgctgc tggcagtggc agcggtggcg       780
     gtagcgatga atcattactg tcgcagtcgc tacgatctgg tggcgatcct caaaacgctg       840
     ggggcagggc gagcgcaact gcgtaagcta atcgtcggtc agtggttgat ggtgctgacg       900
     ctttcagccg ttaccggtgg ggccataggc ctgttgttcg aaaacgtgtt gatggtgctg       960
     ctcaagcccg ttctgcctgc tgcactaccg ccagccagcc tctggccgtg gctgtgggcg      1020
     cttggcacca tgacggtcat ctcgctgctg gtggggctac gaccatatcg cttgttgctg      1080
     gcaacgcagc ctttacgcgt attacgtaat gatgtggtag cgaacgtctg gccgctgaag      1140
     ttttatctgc cgattgtcag tgtggtggtt gtgctgctgc tcgccggatt aatgggtggc      1200
     agcatgctgc tttgggcggt gctggcgggc gcggtagtac tggctttgct gtgcggtgtg      1260
     ctgggctgga tgctgctgaa tgtacttcgc cgcatgacgc tgaaatcgct gcctctgcgc      1320
     ctggcggtta gccgcctgtt acgtcagccg tggtcaacgt taagtcagct ttcggcattt      1380
     tcgctctcct ttatgctgct ggcactgctg ctggtgttgc gtggcgatct gctcgaccgc      1440
     tggcagcagc agctacctcc agaaagcccg aactactttt taattaacat cgccacagaa      1500
     caggtagcac cgctaaaagc gttcctcgcg gaacatcaga tagtcccgga atcgttttat      1560
     ccggtggtgc gggcgcggct gacggcgatt aacgataagc cgacagaagg taatgaagat      1620
     gaggcgctta accgcgaact caatcttacc tggcaaaata cgcggcccga tcataatccg      1680
     attgtcgccg gtaactggcc gccaaaagcc gatgaagtgt cgatggaaga ggggctggcg      1740
     aaacgcttaa acgttgccct cggtgatacc gtgactttta tgggcgatac ccaggagttc      1800
     cgcgctaaag tgaccagcct gcgcaaagtg gactgggaaa gtctgcggcc taatttctat      1860
     tttattttcc ctgaaggggc attagacggg caaccgcaga gctggcttac cagtttccgc      1920
     tgggagaatg gcaacggcat gttgacacaa ctcaaccgcc agttcccgac cattagcctg      1980
     ttagatattg gcgcgatttt aaaacaggtc ggtcaggtgc tggagcaggt aagtcgggcg      2040
     ctggaagtga tggtggtact ggtcaccgcc tgcggtatgt tgctgttgct ggcacaggtg      2100
     caggtgggaa tgcgtcagcg tcatcaggag ctggtggtgt ggcgcacact cggtgcgggg      2160
     aaaaaactgc tgcgtaccac gttgtggtgt gagttcgcca tgcttgggtt tgtttccggc      2220
     ctggtggccg caattggtgc ggaaacggcg ctggcagtgt tgcaggcgaa agtgtttgat      2280
     tttccgtggg agccagactg gcgattgtgg attgttctgc cgtgcagcgg agcgctgctg      2340
     ctgtcgcttt tcggcggctg gctgggtgcg cgactggtta agggtaaggc gctgttcagg      2400
     cagtttgcgg ggtga                                                       2415
//

If you have problems or comments...

PBIL Back to PBIL home page