(data stored in ACNUC7421 zone)

EMBL: CP000948.YBBV

CP000948.YBBV        Location/Qualifiers
FT   CDS_pept        476051..476329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbV"
FT                   /locus_tag="ECDH10B_0466"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01635"
FT                   /protein_id="ACB01635.1"
FT                   /translation="MNRPAILKKKAAKDVASVLKIIFLFYLFLIARLKQRYSIREIKRD
FT                   LWNIRENYSSNAAIAKIYCRKRKASGPGKHLTILPYGWVRFITFPIM"
     atgaatcggc cagcaatatt aaaaaagaaa gcagccaaag atgttgcttc agtattaaaa        60
     ataatatttt tattttattt gttcctcata gctagattaa aacaacgtta ttcgatacgt       120
     gaaattaaga gggatttatg gaacatcaga gaaaactatt ccagcaacgc ggctatagcg       180
     aagatctatt gccgaaaacg caaagccagc ggacctggaa aacatttaac tattttacct       240
     tatggatggg ttcggttcat aacgttccca attatgtga                              279
//

If you have problems or comments...

PBIL Back to PBIL home page