(data stored in ACNUC7421 zone)

EMBL: CP000948.YBCF

CP000948.YBCF        Location/Qualifiers
FT   CDS_pept        488994..489887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybcF"
FT                   /locus_tag="ECDH10B_0477"
FT                   /product="predicted carbamate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01646"
FT                   /protein_id="ACB01646.1"
FT                   /translation="MKTLVVALGGNALLQRGEALTAENQYRNIASAVPALARLARSYRL
FT                   AIVHGNGPQVGLLALQNLAWKEVEPYPLDVLVAESQGMIGYMLAQSLSAQPQMPPVTTV
FT                   LTRIEVSPDDPAFLQPEKFIGPVYQPEEQEALEAAYGWQMKRDGKYLRRVVASPQPRKI
FT                   LDSEAIELLLKEGHVVICSGGGGVPVTDDGAGSEAVIDKDLAAALLAEQINADGLVILT
FT                   DADAVYENWGTPQQRAIRHATPDELAPFAKADGSMGPNVTAVSGYVRSRGKPAWIGALS
FT                   RIEETLAGEAGTCISL"
     atgaaaacac tggttgtggc tcttgggggc aacgccttac tccagcgcgg tgaggcgctg        60
     acggcagaaa atcaatatcg caatatcgcc agtgctgtac ccgcgctggc acgcctggcc       120
     cgttcttatc ggttggcgat tgttcacggc aacgggccgc aggtggggct gctggcattg       180
     cagaatctgg cgtggaaaga ggtagaaccg tatccgctgg atgtgctggt tgcggaaagc       240
     caggggatga ttggctatat gctggcgcag agtttgagcg cacagccgca gatgccgccc       300
     gtgacgacgg tgctgacgcg cattgaggtt tcgcctgatg atccggcgtt tttgcagcca       360
     gagaaattta ttggtccggt ttatcagcca gaagaacaag aggcactgga agcggcttac       420
     ggctggcaga tgaaacgtga tggtaaatat ttgcgccggg tggtggcgtc tccgcaaccg       480
     cgtaaaattc tcgacagcga agccatcgag ttgttgctca aagaggggca tgtggtgatt       540
     tgcagtggcg gcggcggtgt gcctgtgacg gatgacggag cagggagtga agcagtgatt       600
     gataaagatc tcgccgctgc gttgctcgcc gagcagatta atgcagatgg actggtgatc       660
     ctcaccgatg ctgatgcggt atatgaaaac tggggaacgc cgcagcaacg tgccattcgc       720
     catgccacac cggatgagtt agcgccattt gccaaagccg atggttcgat ggggccgaat       780
     gtaacggcgg tgagtggtta tgtcagaagc cgtggtaaac ccgcgtggat tggggcgtta       840
     tcgcgaattg aagagacgct ggcgggcgaa gcggggacct gtatttcgct gtag             894
//

If you have problems or comments...

PBIL Back to PBIL home page