(data stored in ACNUC7421 zone)

EMBL: CP000948.YBCH

CP000948.YBCH        Location/Qualifiers
FT   CDS_pept        complement(525646..526536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybcH"
FT                   /locus_tag="ECDH10B_0525"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01688"
FT                   /protein_id="ACB01688.1"
FT                   /translation="MRKFIFVLLTLLLVSPFSFAMKGIIWQPQNRDSQVTDTQWQGLMS
FT                   QLRLQGFDTLVLQWTRYGDAFTQPEQRTLLFKRAAAAQQAGLKLIVGLNADPEFFMHQK
FT                   QSSAALESYLNRLLAADLQQARLWSAAPGITPDGWYISAEIDDLNWRSEAARQPLLTWL
FT                   NNAQRLISDVSAKPVYISSFFAGNMSPDGYRQLLEHVKATGVNVWVQDGSGVDKLTAEQ
FT                   RERYLQASADCQSPAPASGVVYELFVAGKGKTFTAKPKPDAEIASLLAKRSSCGKDTLY
FT                   FSLRYLPVAHGILEY"
     atgcgtaagt tcattttcgt attgctgaca ctgcttttgg tcagcccttt ttcctttgcg        60
     atgaaaggta ttatctggca accacaaaac cgagatagtc aggttaccga tacccagtgg       120
     caggggctga tgagtcagtt acgtttgcaa ggcttcgata cccttgtttt gcaatggacc       180
     cgttacggcg atgcatttac ccagccagaa cagcgcacgt tattgtttaa gcgggccgca       240
     gctgcgcaac aggctggtct gaagcttatt gtcgggctga acgccgatcc ggaatttttt       300
     atgcaccaga aacagtcgtc cgcagcgctg gaaagctatc ttaatcgcct gctggctgcc       360
     gatctccagc aagccagatt atggagcgcc gcgcctggca taacgccgga tggctggtac       420
     atcagcgcgg aaattgacga cctgaactgg cgcagcgaag ccgcccgtca gcctttgcta       480
     acatggttaa acaacgcgca gcggctgatt agcgatgttt cagcaaaacc ggtttatatc       540
     agtagttttt tcgccggaaa catgtcgccc gatggctatc gccaactgct ggaacacgtt       600
     aaagcaaccg gcgttaatgt ctgggtacag gatggcagcg gcgtggataa actgaccgct       660
     gaacagcgtg aacgttattt acaggccagc gccgattgcc aaagtcccgc ccctgccagc       720
     ggcgttgttt atgaactttt tgtcgccggc aaaggcaaaa cctttacagc gaaaccgaaa       780
     ccggacgcag aaattgcctc gctgttagcg aaacgttcct cttgcggtaa agacactctc       840
     tatttctctc tgcgctattt gcccgtcgcg cacggcattc tcgagtatta a                891
//

If you have problems or comments...

PBIL Back to PBIL home page