(data stored in ACNUC7421 zone)

EMBL: CP000948.YBCI

CP000948.YBCI        Location/Qualifiers
FT   CDS_pept        complement(494587..495108)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybcI"
FT                   /locus_tag="ECDH10B_0483"
FT                   /product="conserved inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01652"
FT                   /protein_id="ACB01652.1"
FT                   /translation="MPTVITHAAVPLCIGLGLGSKVIPPRLLFAGIILAMLPDADVLSF
FT                   KFGVAYGNVFGHRGFTHSLVFAFVVPLLCVFIGRRWFRAGLIRCWLFLTVSLLSHSLLD
FT                   SVTTGGKGVGWLWPWSDERFFAPWQVIKVAPFALSRYTTPYGHQVIISELMWVWLPGML
FT                   LMGMLWWRRR"
     atgccaaccg ttattacgca cgccgccgtt cccctatgca ttggtttagg gttgggttcg        60
     aaagtcatcc ctccgcgtct gttatttgcc ggaatcatcc tggcgatgct gcccgacgcc       120
     gacgtattgt cgtttaaatt tggcgttgct tacggcaatg tttttggtca tcgcgggttt       180
     acccattcgc tggtgtttgc gtttgttgtc ccgctgttat gtgtgtttat tggacgccga       240
     tggttcaggg ctgggctgat tcgctgctgg ctgtttttaa ccgtctcgtt gctatcgcac       300
     agcttgctgg attcggtaac cactggcggt aaaggcgttg gctggctgtg gccgtggtca       360
     gatgaacgct ttttcgctcc ctggcaggtg ataaaagtcg cgccgtttgc attgtctcgt       420
     tacaccacgc cgtacgggca tcaggtgatt atttctgaat tgatgtgggt gtggttgccg       480
     gggatgctac tgatgggaat gttgtggtgg cgcagacgat aa                          522
//

If you have problems or comments...

PBIL Back to PBIL home page