(data stored in ACNUC7421 zone)

EMBL: CP000948.YBCL

CP000948.YBCL        Location/Qualifiers
FT   CDS_pept        509448..509999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybcL"
FT                   /locus_tag="ECDH10B_0501"
FT                   /product="DLP12 prophage; predicted kinase inhibitor"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01668"
FT                   /protein_id="ACB01668.1"
FT                   /translation="MKTLIVSTVLAFITFSAQAAAFQVTSNEIKTGEQLTTSHVFSGFG
FT                   CEGGNTSPSLTWSGVPEGTKSFAVTVYDPDAPTGSGWWHWTVVNIPATVTYLPVDAGRR
FT                   DGTKLPTGAVQGRNDFGYAGFGGACPPKGDKPHHYQFKVWALKTEKIPVDSNSSGALVG
FT                   YMLNANKIATAEITPVYEIK"
     atgaaaacac ttatcgtttc aactgtattg gcattcataa cattttctgc gcaggctgca        60
     gcatttcagg tcactagtaa tgaaataaaa acaggagagc aacttacaac gtctcatgtc       120
     ttttctggat ttgggtgtga aggtggtaat acatcgccct cattaacctg gtctggtgtt       180
     cctgaaggta ccaaaagctt tgccgtaact gtatatgatc cagatgcacc tacaggcagt       240
     ggttggtggc attggactgt tgttaatatt ccagcaacag taacatattt gcccgttgat       300
     gcagggagac gtgatggaac aaaactgccg actggtgctg ttcaaggccg aaatgatttt       360
     ggctatgctg ggtttggtgg cgcatgtcct cctaaaggag ataaaccaca tcattaccag       420
     tttaaagtat gggctctaaa aactgaaaag attcctgtag attctaactc cagcggagcg       480
     ttagttggtt atatgcttaa tgctaataaa atcgcaaccg ctgagataac accagtttat       540
     gagataaagt ag                                                           552
//

If you have problems or comments...

PBIL Back to PBIL home page