(data stored in ACNUC7421 zone)

EMBL: CP000948.YBCN

CP000948.YBCN        Location/Qualifiers
FT   CDS_pept        511021..511476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybcN"
FT                   /locus_tag="ECDH10B_0503"
FT                   /product="DLP12 prophage; predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01670"
FT                   /protein_id="ACB01670.1"
FT                   /translation="MNLSQDGIKLHRGNFTAIGRQIQPYLEEGKCFRMVLKPWREKRSL
FT                   SQNALSHMWYSEISEYLISRGKTFATPAWVKDALKHTYLGYETKDLVDVVTGDITTIQS
FT                   LRHTSDLDTGEMYVFLCKVEAWAMNIGCHLTIPQSCEFQLLRDKQEA"
     gtgaacctct cacaagacgg catcaaatta catcgcggca acttcaccgc tatcggtcgg        60
     cagatccagc cttatctgga ggagggcaaa tgctttcgca tggtgcttaa accgtggcgt       120
     gagaaacgca gtctttccca gaatgcactc agccacatgt ggtacagcga aatcagtgaa       180
     tacctcatca gcaggggtaa aacgttcgcc actccagctt gggtaaaaga tgctctcaaa       240
     cacacatatc tcggttatga aaccaaagac ctggttgatg tcgtaaccgg tgatatcacc       300
     actatccagt cgttacgcca tacctccgat cttgataccg gagagatgta tgtcttcctg       360
     tgtaaggttg aagcctgggc gatgaatatt ggttgccacc tgactattcc acagagctgc       420
     gagttccagc tgctgcgcga caagcaggag gcgtaa                                 456
//

If you have problems or comments...

PBIL Back to PBIL home page