(data stored in ACNUC7421 zone)

EMBL: CP000948.YBCO

CP000948.YBCO        Location/Qualifiers
FT   CDS_pept        511639..511929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybcO"
FT                   /locus_tag="ECDH10B_0505"
FT                   /product="DLP12 prophage; predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01672"
FT                   /protein_id="ACB01672.1"
FT                   /translation="MADLRKAARGRECQVRIPGVCNGNPETSVLAHIRLTGLCGTGTKP
FT                   PDLIATIACSACHDEIDRRTHFVDAGYAKECALEGMARTQVIWLKEGVIKA"
     atggctgatt tgagaaaagc agcgcgtggt cgggaatgcc aggtaagaat ccctggcgta        60
     tgtaatggca accctgaaac gtctgtactg gcacatatcc ggctgactgg attgtgcggc       120
     accggtacga aaccgccaga cctgattgcc accattgcat gttctgcctg ccacgacgaa       180
     atcgaccgcc gcacgcattt tgttgacgct ggatatgcaa aagaatgcgc gctggaaggt       240
     atggcgagaa cacaggttat ctggctgaaa gagggggtta ttaaggcgtg a                291
//

If you have problems or comments...

PBIL Back to PBIL home page