(data stored in ACNUC7421 zone)

EMBL: CP000948.YBCQ

CP000948.YBCQ        Location/Qualifiers
FT   CDS_pept        512511..512894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybcQ"
FT                   /locus_tag="ECDH10B_0508"
FT                   /product="DLP12 prophage; predicted antitermination
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01675"
FT                   /protein_id="ACB01675.1"
FT                   /translation="MRDIQMVLERWGAWAANNHEDVTWSSIAAGFKGLITSKVKSRPQC
FT                   CDDDAMIICGCMARLKKNNSDLHDLLVDYYVVGMTFMSLAGKHCCSDGYIGKRLQKAEG
FT                   IIEGMLMALDIRLEMDIVVNNSN"
     atgcgtgata ttcagatggt tcttgagcgt tggggagcgt gggcggctaa taatcatgaa        60
     gatgtgacct ggtcgtccat tgccgccggt tttaagggat taattacttc aaaagtaaaa       120
     tctcgcccgc aatgttgtga cgatgacgcg atgatcattt gcgggtgcat ggcccgtctg       180
     aaaaagaaca acagcgattt gcacgattta ttagtagatt attatgtagt cggtatgaca       240
     ttcatgtcac tggcaggtaa gcattgctgc tctgatggtt atatcgggaa aaggttacag       300
     aaggctgagg gcataattga agggatgtta atggcattag atatccggtt agagatggat       360
     atcgttgtta ataactctaa ttaa                                              384
//

If you have problems or comments...

PBIL Back to PBIL home page