(data stored in ACNUC7421 zone)

EMBL: CP000948.YBCV

CP000948.YBCV        Location/Qualifiers
FT   CDS_pept        complement(517739..518149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybcV"
FT                   /locus_tag="ECDH10B_0516"
FT                   /product="DLP12 prophage; predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01682"
FT                   /protein_id="ACB01682.1"
FT                   /translation="MAQVAIFKEIFDQVRKDLNCELFYSELKRHNVSHYIYYLATDNIH
FT                   IVLENDNTVLIKGLKKVVNVKFSRNTHLIETSYDRLKSREITFQQYRENLAKAGVFRWI
FT                   TNIHEHKRYYYTFDNSLLFTESIQNTTQIFPR"
     atggctcagg ttgccatttt taaagaaata ttcgatcaag tgcgaaaaga tttaaactgt        60
     gaattgtttt attctgaact aaaacgtcac aatgtctcac attatattta ctatctagcc       120
     acagataata ttcacattgt gttagaaaac gataacaccg tgttaataaa aggacttaaa       180
     aaggttgtaa atgttaaatt ctcaagaaat acgcatctta tagaaacgtc ctatgatagg       240
     ttgaaatcaa gagaaatcac atttcagcaa tacagggaaa atcttgctaa agcaggagtt       300
     ttccgatgga ttacaaatat ccacgaacat aaaagatatt actatacctt tgataattca       360
     ttactattta ctgagagcat tcagaacact acacaaatct ttccacgcta a                411
//

If you have problems or comments...

PBIL Back to PBIL home page