(data stored in ACNUC7421 zone)

EMBL: CP000948.YBDB

CP000948.YBDB        Location/Qualifiers
FT   CDS_pept        567855..568268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdB"
FT                   /locus_tag="ECDH10B_0557"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01720"
FT                   /protein_id="ACB01720.1"
FT                   /translation="MIWKRHLTLDELNATSDNTMVAHLGIVYTRLGDDVLEAEMPVDTR
FT                   THQPFGLLHGGASAALAETLGSMAGFMMTRDGQCVVGTELNATHHRPVSEGKVRGVCQP
FT                   LHLGRQNQSWEIVVFDEQGRRCCTCRLGTAVLG"
     atgatctgga aacgccattt aacgctcgac gaactgaacg ccaccagcga taacacaatg        60
     gtggcgcatc tgggaattgt gtatacccgt ctgggcgatg atgtgctgga agccgaaatg       120
     ccggttgata cccgtactca tcagccgttc ggtttactac atggcggcgc gtcggcggcg       180
     ctggcggaaa cgctgggatc gatggccgga tttatgatga cccgcgacgg acagtgtgtg       240
     gtaggcacag aacttaatgc aacacaccat cgcccggtgt ctgagggaaa ggtacgcggc       300
     gtctgccagc cgctgcatct tggtcggcaa aatcagagct gggaaatcgt cgttttcgat       360
     gaacaggggc ggcgttgctg cacttgtcgg ctgggtacgg cagttttggg atga             414
//

If you have problems or comments...

PBIL Back to PBIL home page