(data stored in ACNUC7421 zone)

EMBL: CP000948.YBDJ

CP000948.YBDJ        Location/Qualifiers
FT   CDS_pept        complement(544506..544754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdJ"
FT                   /locus_tag="ECDH10B_0538"
FT                   /product="predicted inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01701"
FT                   /protein_id="ACB01701.1"
FT                   /translation="MKHPLETLTTAAGILLMAFLSCLLLPAPALGLALAQKLVTMFHLM
FT                   DLSQLYTLLFCLWFLVLGAIEYFVLRFIWRRWFSLAD"
     atgaaacacc ctttagaaac cttgaccacc gcagcaggca ttttgctgat ggctttcctc        60
     tcttgcctgc tgctgcccgc ccccgcactg gggctggcgc tggcacaaaa actggtgacc       120
     atgttccatc tgatggatct tagtcagctt tacactttat tgttttgtct gtggttttta       180
     gtgctgggcg ctattgagta ttttgttctg cgctttatct ggcgacgctg gttctcgctg       240
     gcggattaa                                                               249
//

If you have problems or comments...

PBIL Back to PBIL home page