(data stored in ACNUC7421 zone)

EMBL: CP000948.YBDZ

CP000948.YBDZ        Location/Qualifiers
FT   CDS_pept        552497..552715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdZ"
FT                   /locus_tag="ECDH10B_0545"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01708"
FT                   /protein_id="ACB01708.1"
FT                   /translation="MAFSNPFDDPQGAFYILRNAQGQFSLWPQQCVLPAGWDIVCQPQS
FT                   QASCQQWLEAHWRTLTPTNFTQLQEAQ"
     atggcattca gtaatccctt cgatgatccg cagggagcgt tttacatatt gcgcaatgcg        60
     caggggcaat tcagtctgtg gccgcaacaa tgcgtcttac cggcaggctg ggacattgtg       120
     tgtcagccgc agtcacaggc gtcctgccag cagtggctgg aagcccactg gcgtactctg       180
     acaccgacga attttaccca gttgcaggag gcacaatga                              219
//

If you have problems or comments...

PBIL Back to PBIL home page