(data stored in ACNUC7421 zone)

EMBL: CP000948.YBEQ

CP000948.YBEQ        Location/Qualifiers
FT   CDS_pept        complement(614125..615102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybeQ"
FT                   /locus_tag="ECDH10B_0605"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01765"
FT                   /protein_id="ACB01765.1"
FT                   /translation="MIFTSSCCDNLSIDEIIERAEKGDCEAQYIVGFYYNRDSAIDSPD
FT                   DEKAFYWLKLAAEQGHCEAQYSLGQKYTEDKSRHKDNEQAIFWLKKAALQGHTFASNAL
FT                   GWTLDRGEAPNYKEAVVWYQIAAESGMSYAQNNLGWMYRNGNGVAKDYALAFFWYKQAA
FT                   LQGHSDAQNNLADLYEDGKGVAQNKTLAAFWYLKSAQQGNRHAQFQIAWDYNAGEGVDQ
FT                   DYKQAMYWYLKAAAQGSVGAYVNIGYMYKHGQGVEKDYQAAFEWFTKAAECNDATAWYN
FT                   LAIMYHYGEGRPVDLRQALDLYRKVQSSGTRDVSQEIRETEDLL"
     atgattttca cgtcaagttg ctgcgataat ttatcaatag atgagattat cgaacgtgct        60
     gaaaaaggcg attgcgaggc tcaatatatt gttgggtttt attataatcg cgatagcgca       120
     attgattctc cggacgacga aaaagccttt tactggctga agctggccgc tgagcaaggt       180
     cattgtgaag cacagtattc cttagggcaa aagtataccg aggataaaag ccgtcataaa       240
     gataatgagc aagccatctt ctggctgaaa aaagctgccc tacaaggcca tactttcgct       300
     tccaacgccc ttggctggac actggatcgt ggagaagccc ccaattataa agaagcggtt       360
     gtctggtatc agatagccgc ggagagcgga atgtcttatg cgcaaaataa tcttgggtgg       420
     atgtacagaa atggcaacgg agtcgcaaaa gactatgcgc tggcattttt ctggtacaaa       480
     caagctgcat tacaaggcca tagtgacgcg caaaacaatc tggccgatct ttatgaagac       540
     ggaaaaggcg ttgctcaaaa caagacactc gccgcattct ggtatttgaa aagcgcacag       600
     cagggtaatc ggcacgccca gtttcaaatt gcatgggatt ataacgctgg cgaaggggtg       660
     gaccaggact ataagcaagc gatgtactgg tatctgaagg ctgccgctca ggggagcgtc       720
     ggcgcttacg tcaacatcgg ttatatgtat aaacacggac aaggcgttga gaaagattat       780
     caggctgcct ttgaatggtt tacgaaagcc gctgaatgca atgacgccac tgcctggtat       840
     aacctggcca ttatgtatca ctacggagaa ggaagacctg tcgatctccg acaggctctc       900
     gacctgtatc gtaaagttca gtcatccgga accagagatg tcagtcagga aattcgtgag       960
     actgaagatt tactgtag                                                     978
//

If you have problems or comments...

PBIL Back to PBIL home page