(data stored in ACNUC7421 zone)

EMBL: CP000948.YBEZ

CP000948.YBEZ        Location/Qualifiers
FT   CDS_pept        complement(744153..745193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybeZ"
FT                   /locus_tag="ECDH10B_0729"
FT                   /product="predicted protein with nucleoside triphosphate
FT                   hydrolase domain"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0729"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01882"
FT                   /protein_id="ACB01882.1"
FT                   /translation="MNIDTREITLEPADNARLLSLCGPFDDNIKQLERRLGIEINRRDN
FT                   HFKLTGRPICVTAAADILRSLYVDTAPMRGQIQDIEPEQIHLAIKEARVLEQSAESVPE
FT                   YGKAVNIKTKRGVIKPRTPNQAQYIANILDHDITFGVGPAGTGKTYLAVAAAVDALERQ
FT                   EIRRILLTRPAVEAGEKLGFLPGDLSQKVDPYLRPLYDALFEMLGFEKVEKLIERNVIE
FT                   VAPLAYMRGRTLNDAFIILDESQNTTIEQMKMFLTRIGFNSKAVITGDVTQIDLPRNTK
FT                   SGLRHAIEVLADVEEISFNFFHSEDVVRHPVVARIVNAYEAWEEAEQKRKAALAAERKR
FT                   EEQEQK"
     ttgaacatag acactcgcga aatcaccctg gagccagcag acaatgcgcg tctgttgagc        60
     ctgtgcggcc cgtttgatga caacatcaag cagctcgaac gccgtctcgg catcgagatc       120
     aatcgccgcg ataaccactt taaactgacc ggccgtccga tttgcgtcac cgctgcggca       180
     gacattctgc gtagcctgta tgtcgatact gccccgatgc gcggtcagat tcaggatatc       240
     gaaccggaac agatccacct tgcgattaaa gaagcgcggg tactggagca aagcgcggag       300
     agcgtgccgg agtacggcaa agcggtcaat atcaaaacca aacgcggcgt aattaagccg       360
     cgcacgccaa accaggcgca gtacatcgcc aatattctcg accatgacat taccttcggc       420
     gttggcccgg cgggtacggg taaaacctac ctggcagtgg ctgcggcagt tgatgccctg       480
     gagcgtcagg aaattcgccg tattctgctg actcgtccgg cagtagaagc cggtgagaaa       540
     ctgggcttcc tgcctggcga tttaagccag aaagtagacc cgtatctgcg cccgctgtac       600
     gacgcgctgt ttgaaatgct gggctttgag aaagtcgaga aactgattga gcgcaacgtt       660
     attgaagtcg caccgctggc ctatatgcgt ggtcgtacgc tgaacgacgc gtttatcatt       720
     ctcgatgaga gccagaacac caccatcgaa cagatgaaga tgttcctgac ccgtatcggt       780
     tttaactcaa aagcggttat caccggcgac gtcacacaga tcgacctgcc gcgtaatact       840
     aaatcaggct tacgtcacgc catcgaagtg ctggccgatg tcgaagagat cagctttaac       900
     ttcttccaca gcgaagacgt ggttcgtcac cctgtggtgg cgcgtatcgt taacgcctat       960
     gaagcctggg aagaagccga acaaaaacga aaagcggcgc tggcagcaga acgcaagcgc      1020
     gaagaacagg aacaaaaatg a                                                1041
//

If you have problems or comments...

PBIL Back to PBIL home page