(data stored in ACNUC7421 zone)

EMBL: CP000948.YBFB

CP000948.YBFB        Location/Qualifiers
FT   CDS_pept        785591..785917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybfB"
FT                   /locus_tag="ECDH10B_0768"
FT                   /product="predicted inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0768"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01911"
FT                   /protein_id="ACB01911.1"
FT                   /translation="MKYIIFLFRAIWLALSLLILFFSMHRLSLLDSTRDVSELISLMSY
FT                   GMMVICFPTGIVFFIALIFIGTVSDIIGVRIDSKYIMAIIIWLYFLSGGYIQWFVLSKR
FT                   IINK"
     atgaaatata ttattttttt attcagagct atatggctgg ctttatcgct tttaatacta        60
     ttcttttcca tgcatagact ttcactatta gactccactc gtgatgtgag cgagttaatt       120
     agtctcatgt cttatggaat gatggtaata tgttttccaa caggcatagt attctttatt       180
     gctctaatat ttatagggac tgtatcagac attattggcg taaggattga tagtaagtat       240
     attatggcga taataatatg gctttatttt ctgtcaggag ggtatattca atggtttgta       300
     ttaagtaagc gcattataaa caaataa                                           327
//

If you have problems or comments...

PBIL Back to PBIL home page