(data stored in ACNUC7421 zone)

EMBL: CP000948.YBFC

CP000948.YBFC        Location/Qualifiers
FT   CDS_pept        787465..788034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybfC"
FT                   /locus_tag="ECDH10B_0770"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0770"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01913"
FT                   /protein_id="ACB01913.1"
FT                   /translation="MKRVLFFLLMIFVSFGVIADCEIQAKDHDCFTIFAKGTIFSAFPV
FT                   LNNKAMWRWYQNEDIGEYYWQTELGTCKNNKFTPSGARLLIRVGSLRLNENHAIKGTLQ
FT                   ELINTAEKTAFLGDRFRSYIRAGIYQKKSSDPVQLLAVLDNSIMVKYFKDEKPTYARMT
FT                   AHLPNKNESYECLIKIQHELIRSEEK"
     atgaaaagag ttttgttctt tttgctgatg atatttgtta gttttggtgt tatagctgat        60
     tgcgaaatac aagctaaaga tcatgattgt tttactattt tcgctaaggg tactattttt       120
     tccgcgtttc ctgtcttaaa taataaagcc atgtggagat ggtatcagaa tgaggacatc       180
     ggtgagtatt attggcaaac agaactgggt acatgtaaaa ataataaatt cacaccaagc       240
     ggggcgagac tcttaattcg cgtcgggtca ctacgcctta atgaaaatca tgccatcaaa       300
     ggaacgttgc aggagttgat aaatacagca gaaaaaacgg cgtttctcgg cgatcggttt       360
     agaagttata taagagcggg tatctatcaa aaaaagagca gtgatccagt tcagttgttg       420
     gcagtccttg ataattcaat catggtaaaa tattttaaag atgagaaacc aacttatgct       480
     cgaatgacag cacatctccc gaacaaaaat gagtcttacg aatgtttaat aaagatacag       540
     catgaactaa ttcgtagtga agagaaataa                                        570
//

If you have problems or comments...

PBIL Back to PBIL home page