(data stored in ACNUC7421 zone)

EMBL: CP000948.YBFD

CP000948.YBFD        Location/Qualifiers
FT   CDS_pept        789907..790668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybfD"
FT                   /locus_tag="ECDH10B_0773"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0773"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01915"
FT                   /protein_id="ACB01915.1"
FT                   /translation="MELKKLMEHISIIPDYRQAWKVEHKLSDILLLTICAVISGAEGWE
FT                   DIEDFGETHPDFLKQYGDFENGIPVHDTIARVVSCICPAKFHESFINWMLDYHSSDDKD
FT                   VIAIDGKIHRHSYDKSRRKGAIHVISAFSTMHSLVIGQIKTDKKSNEITAIPELLNMLD
FT                   IKGKIIKTDAMGCQKDIAEKIQKQGGDYLFAVKGNQGRLNKAFEEKFPLKELNNPKHDS
FT                   YAISEKSHGREETRLHIVCDVPDELIDFTFE"
     atggaactta aaaaattgat ggaacatatt tctattatcc ccgattacag acaagcctgg        60
     aaagtggaac ataaattatc ggatattcta ctgttgacta tttgtgccgt tatttctggt       120
     gcagaaggct gggaagatat agaggatttt ggggaaacac atcccgattt tttgaagcaa       180
     tatggtgatt ttgaaaatgg tattcctgtt cacgatacca ttgccagagt tgtatcctgt       240
     atctgtcctg cgaaatttca tgagagcttt attaactgga tgcttgacta ccattcttca       300
     gatgataaag acgtcatcgc aattgatgga aaaatacacc ggcattctta tgacaagagt       360
     cgccgtaagg gagcgattca tgtcattagt gcgttctcaa caatgcacag tctggtcatc       420
     ggacagatca agacggataa gaaatccaat gagatcacag ctatccctga acttcttaac       480
     atgctggata ttaaaggaaa aatcatcaaa accgatgcga tgggttgcca gaaagatatt       540
     gcagagaaga tacaaaaaca gggaggtgat tatttattcg ctgtaaaagg aaaccagggg       600
     cggctaaata aagccttcga ggaaaaattt ccgctgaaag aattaaataa tcccaagcat       660
     gacagttacg caattagtga aaagagtcac ggcagagaag aaacccgtct tcatattgtt       720
     tgcgatgtcc ctgatgagct tattgatttc acgtttgaat ag                          762
//

If you have problems or comments...

PBIL Back to PBIL home page