(data stored in ACNUC7421 zone)

EMBL: CP000948.YBGD

CP000948.YBGD        Location/Qualifiers
FT   CDS_pept        complement(804044..804610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybgD"
FT                   /locus_tag="ECDH10B_0786"
FT                   /product="predicted fimbrial-like adhesin protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0786"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01928"
FT                   /protein_id="ACB01928.1"
FT                   /translation="MFKGQKTLAALAVSLLFTAPVYAADEGSGEIHFKGEVIEAPCEIH
FT                   PEDIDKNIDLGQVTTTHINREHHSNKVAVDIRLINCDLPASDNGSGMPVSKVGVTFDST
FT                   AKTTGATPLLSNTSAGEATGVGVRLMDKNDGNIVLGSAAPDLDLDASSSEQTLNFFAWM
FT                   EQIDNAVDVTAGEVTANATYVLDYK"
     atgtttaaag gacaaaaaac attggccgca ctggccgtat ctctgctgtt cactgcacct        60
     gtttatgctg ctgatgaagg ttctggcgaa attcacttta agggggaggt tattgaagca       120
     ccttgtgaaa ttcatccaga agatattgat aaaaacatag atcttggaca agtcacgaca       180
     acccatataa accgggagca tcatagcaat aaagtggccg tcgacattcg cttgatcaac       240
     tgtgatctgc ctgcttctga caacggtagc ggaatgccgg tatccaaagt tggcgtaacc       300
     ttcgatagca cggctaagac aactggtgct acgcctttgt tgagcaacac cagtgcaggc       360
     gaagcaactg gggtcggtgt acgactgatg gacaaaaatg acggtaacat cgtattaggt       420
     tcagccgcgc cagatcttga cctggatgca agctcatcag aacagacgct gaactttttc       480
     gcctggatgg aacaaattga taatgcagtc gatgtcacgg caggtgaagt aaccgctaac       540
     gcaacctacg tgctggatta taaataa                                           567
//

If you have problems or comments...

PBIL Back to PBIL home page