(data stored in ACNUC7421 zone)

EMBL: CP000948.YBGJ

CP000948.YBGJ        Location/Qualifiers
FT   CDS_pept        795408..796064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybgJ"
FT                   /locus_tag="ECDH10B_0778"
FT                   /product="predicted enzyme subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0778"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01920"
FT                   /protein_id="ACB01920.1"
FT                   /translation="MQRARCYLIGETAVVLELEPPVTLASQKRIWRLAQRLVDMPNVVE
FT                   AIPGMNNITVILRNPESLALDAIERLQRWWEESEALEPESRFIEIPVVYGGAGGPDLAV
FT                   VAAHCGLSEKQVVELHSSVEYVVWFLGFQPGFPYLGSLPEQLHTPRRAEPRLLVPAGSV
FT                   GIGGPQTGVYPLATPGGWQLIGHTSLSLFDPARDEPILLRPGDSVRFVPQKEGVC"
     gtgcaacgag cgcgttgtta tctgataggt gaaacggcgg tagtgctgga actggaaccg        60
     ccggtgacgc tggctagcca gaaacggatc tggcgactgg cgcagcgtct ggtggatatg       120
     ccgaatgtgg ttgaagccat tcccggcatg aacaatatca cggtgatttt gcgtaatcct       180
     gagtcgctgg cgctggatgc catagagcgt ttgcaacgct ggtgggagga gagcgaggcg       240
     ctggagccgg agtctcgctt tattgaaatt ccggtggttt acggtggtgc aggcggaccg       300
     gatttggcgg tggtcgcggc gcattgcggg ttgagcgaaa aacaggttgt tgaattgcac       360
     tcctccgtgg aatacgtggt ctggttttta ggttttcaac cgggcttccc gtatctcggg       420
     agtttgccgg aacaactaca cacgccacgg cgcgctgaac cgcgcttact cgttccggca       480
     ggttctgtcg ggatcggcgg gccgcagact ggtgtttatc cgctggcaac gccgggtggc       540
     tggcagttga ttggtcatac ctcactcagc ctgtttgatc cggcgcgtga cgaacccatc       600
     ttattacgtc cgggagacag cgtgcgcttt gtaccgcaga aggagggagt atgctga          657
//

If you have problems or comments...

PBIL Back to PBIL home page