(data stored in ACNUC7421 zone)

EMBL: CP000948.YBGK

CP000948.YBGK        Location/Qualifiers
FT   CDS_pept        796058..796990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybgK"
FT                   /locus_tag="ECDH10B_0779"
FT                   /product="predicted enzyme subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0779"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01921"
FT                   /protein_id="ACB01921.1"
FT                   /translation="MLKIIRAGMYTTVQDGGRHGFRQSGISHCGALDMPALRIANLLVG
FT                   NDANAPALEITLGQLTVEFETDGWFALTGAGCEARLDDNAVWTGWRLPMKAGQRLTLKR
FT                   PQHGMRSYLAVAGGIDVPPVMGSCSTDLKVGIGGLEGRLLKDGDRLPIGKSKRDSMEAQ
FT                   GVKQLLWGNRIRALPGPEYHEFDRASQDAFWRSPWQLSSQSNRMGYRLQGQILKRTTDR
FT                   ELLSHGLLPGVVQVPHNGQPIVLMNDAQTTGGYPRIACIIEADMYHLAQIPLGQPIHFV
FT                   QCSLEEALKARQDQQRYFEQLAWRLHNEN"
     atgctgaaga ttattcgtgc gggcatgtat accactgtgc aggatggcgg tcgtcacggt        60
     tttcgccagt cgggtatcag ccactgcggc gcactggata tgcccgcgtt acgcattgct       120
     aacctactgg tgggtaatga cgccaatgcc cccgcgctgg agatcacgct cggtcagtta       180
     actgttgagt tcgaaactga tgggtggttt gctctgacgg gtgccggttg cgaagcgcgg       240
     ctggatgata atgccgtctg gaccggctgg cgattgccga tgaaagcagg ccagcgttta       300
     acgcttaaac gcccgcagca cgggatgcgc agttatctgg cggtcgcggg tggtattgat       360
     gttccgccgg taatgggctc atgcagcacc gatctcaaag tggggattgg cgggctggaa       420
     ggccgtttac tgaaggatgg tgaccgactc ccgattggca aatcgaagcg tgattctatg       480
     gaagcgcagg gcgttaaaca gctgctgtgg ggcaaccgca ttcgcgcctt gccggggccg       540
     gaatatcatg agttcgatcg cgcctcgcag gatgcattct ggcgttcgcc ctggcagctt       600
     agctcgcaaa gtaaccgcat gggctatcgc ttacaggggc aaattttaaa acgcaccacc       660
     gatcgcgaac tgttatctca cggtttgtta ccgggcgtgg tgcaggtgcc acataacggg       720
     cagccgattg tgttgatgaa cgacgcacag accaccggtg gttacccgcg tattgcctgt       780
     atcattgagg ctgatatgta ccatctggcg caaattccgc tcggtcagcc gattcatttt       840
     gtccagtgtt cactggaaga ggcactaaaa gcacggcaag atcagcaacg ttattttgaa       900
     caattagcgt ggcggctgca caatgaaaat tga                                    933
//

If you have problems or comments...

PBIL Back to PBIL home page