(data stored in ACNUC7421 zone)

EMBL: CP000948.YBGL

CP000948.YBGL        Location/Qualifiers
FT   CDS_pept        796980..797714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybgL"
FT                   /locus_tag="ECDH10B_0780"
FT                   /product="predicted lactam utilization protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0780"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01922"
FT                   /db_xref="GOA:B1X6P4"
FT                   /db_xref="InterPro:IPR005501"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1X6P4"
FT                   /protein_id="ACB01922.1"
FT                   /translation="MKIDLNADLGEGCASDAELLTLVSSANIACGFHAGDAQIMQACVR
FT                   EAIKNGVAIGAHPSFPDRENFGRSAMQLPPETVYAQTLYQIGALATIARAQGGVMRHVK
FT                   PHGMLYNQAAKEAQLADAIARAVYACDPALILVGLAGSELIRAGKQYGLTTREEVFADR
FT                   GYQADGSLVPRSQSGALIENEEQALAQTLEMVQHGRVKSITGEWATVAAQTVCLHGDGE
FT                   HALAFARRLRSAFAEKGIVVAA"
     atgaaaattg acctgaacgc cgatctgggc gaaggctgcg ccagcgacgc agagctatta        60
     acgctggttt cctctgccaa tattgcctgt ggatttcatg caggcgatgc gcaaatcatg       120
     caggcttgcg tgcgtgaagc aataaaaaat ggtgtcgcga ttggcgctca cccgagtttt       180
     cccgacaggg aaaattttgg tcgcagcgcc atgcagctgc cgccagaaac cgtttacgcc       240
     cagacgctgt atcaaattgg cgcgctggca acgattgccc gtgcgcaagg cggcgtaatg       300
     cgtcatgtca aaccgcacgg catgttgtac aaccaggcgg cgaaagaagc acaactggca       360
     gacgccatcg ccagagcggt atacgcttgc gatccagcat tgattctcgt cgggctggcg       420
     ggaagcgagc tgattcgtgc aggcaagcaa tatggtctga caacgcgcga ggaagtgttt       480
     gccgatcgcg gttatcaggc tgacggctcg ctggtgccgc gaagccagtc aggcgcgttg       540
     attgaaaacg aagaacaggc gctggcgcaa acgctggaga tggtgcaaca cggcagagtc       600
     aaaagtatca ccggcgaatg ggcaacggtc gcggcgcaaa cggtctgcct gcatggcgac       660
     ggcgagcacg cactggcgtt cgcccgccga ctacgctctg catttgccga aaaggggatt       720
     gttgtcgcag cataa                                                        735
//

If you have problems or comments...

PBIL Back to PBIL home page