(data stored in ACNUC7421 zone)

EMBL: CP000948.YBGO

CP000948.YBGO        Location/Qualifiers
FT   CDS_pept        complement(799736..800797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybgO"
FT                   /locus_tag="ECDH10B_0783"
FT                   /product="predicted fimbrial-like adhesin protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0783"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01925"
FT                   /protein_id="ACB01925.1"
FT                   /translation="MSAGKGLLLVICLLFLPLKSAMALNCYFGTSGGAVEKSEAIQPFA
FT                   VPGNAKPGDKIWESDDIKIPVYCDNNTNGNFESEHVYAWVNPYPGVQDRYYQLGVTYNG
FT                   VDYDASLGKSRIDTNQCIDSKNIDIYTPEQIIAMGWQNKICSGDPANIHMSRTFLARMR
FT                   LYVKIREMPPHDYQSTLSDYIVVQFDGAGSVNEDPTAQNLKYHITGLENIRVLDCSVNF
FT                   SISPETQVIDFGKFNLLDIRRHTMSKTFSIKTTKSQNDQCTDGFKVSSSFYTEETLVEE
FT                   DKALLIGNGLKLRLLDENASPYTFNKYAEYADFTSDMLVYEKTYTAELSSIPGTPIEAG
FT                   PFDTVVLFKINYN"
     atgagtgctg gcaagggatt gttgctcgtc atctgcctgt tatttctgcc gttgaagtct        60
     gcaatggcgc tgaactgcta ttttggtaca tctggtggcg cagtagaaaa atcagaagcg       120
     attcaaccgt ttgctgtacc aggcaatgcc aaacccggtg ataagatctg ggaatctgac       180
     gatattaaaa ttcccgtcta ttgtgacaac aataccaacg gcaactttga aagcgagcat       240
     gtctacgcct gggtaaaccc ctatccgggg gtgcaggatc gttattatca actcggcgtg       300
     acatacaacg gtgtcgatta cgatgccagt ctgggaaaaa gtcgcatcga cactaaccag       360
     tgtatcgaca gtaagaacat tgatatttat acccctgagc agatcatcgc gatgggatgg       420
     cagaacaaaa tttgctcggg cgatcccgct aatattcata tgtcgcgtac ctttctcgct       480
     cgcatgcggt tatacgtcaa aatacgagaa atgccgccgc atgattatca aagtacgctt       540
     agcgactata tcgtcgtgca atttgacggt gccggtagcg ttaacgaaga ccctactgcc       600
     caaaacctga aatatcatat tactggtctg gaaaacattc gcgtgctgga ttgcagcgtc       660
     aatttttcca tttcaccgga aacacaggtg attgattttg gtaaatttaa tttgctggat       720
     atacgtcgcc acacaatgtc gaaaacgttc agtattaaaa cgaccaagag ccaaaacgat       780
     caatgcaccg acggatttaa agtcagttcc tccttttata ccgaagaaac gttggttgaa       840
     gaagataaag cattgttgat tggtaatggt ctgaagctac gtttactgga tgaaaacgcc       900
     tcgccttata ccttcaataa atatgctgaa tacgccgatt tcaccagtga catgttggtc       960
     tacgaaaaaa cctatacggc tgaactttcg tccattccag gcacccccat cgaggctggc      1020
     cccttcgata cagtggtgct ttttaagatt aactataact ga                         1062
//

If you have problems or comments...

PBIL Back to PBIL home page