(data stored in ACNUC7421 zone)

EMBL: CP000948.YBGP

CP000948.YBGP        Location/Qualifiers
FT   CDS_pept        complement(800794..801522)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybgP"
FT                   /locus_tag="ECDH10B_0784"
FT                   /product="predicted assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0784"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01926"
FT                   /protein_id="ACB01926.1"
FT                   /translation="MTFIKGLPLMLLTISLGCNAAVQPDRTRIVFNANDKATSLRIENQ
FT                   SDKLPYLAYSWIENEKGEKSDALLVALPPIQRLEPKATSQVRVVKQASTTQLPGDRETL
FT                   FFYNMREIPPAPDKSSDHAILQVAIQSRIKLFWRPAALRKKAGEKVELQLQVSQQGNQL
FT                   TLKNPTAYYLTIAYLGRNEKGVLPGFKTVMVAPFSTVNTNTGSYSGSQFYLGYMDDYGA
FT                   LRMTTLNCSGQCRLQAVEAK"
     atgacattta ttaaaggatt acccttaatg ttgttaacca tcagcttggg ttgcaatgct        60
     gcggtgcaac ccgatcgcac acgcattgtg tttaacgcca atgacaaagc caccagcctg       120
     cgtatcgaaa accaaagtga caaactgcct tatcttgctt attcctggat agaaaatgaa       180
     aaaggggaga aaagcgatgc tcttctggtc gctttgcccc ctattcaacg tctggaaccg       240
     aaagcgacat cgcaggtgcg ggttgtgaaa caagcctcaa ccacacaatt acctggcgat       300
     cgcgaaacgc tatttttcta caatatgcgc gaaattcctc ccgctccgga taaaagcagc       360
     gaccatgcga tacttcaggt cgctattcaa agtcgtatta aattgttctg gcgaccggct       420
     gcattacgca agaaagcagg agaaaaggtc gaactgcagt tacaggtcag ccagcagggc       480
     aaccaactga cactgaaaaa tcctaccgcg tattatctga ccattgccta tctggggaga       540
     aatgaaaaag gcgttctccc aggcttcaaa accgtgatgg ttgcaccttt tagtacggtc       600
     aacacaaaca ccggaagtta tagcggcagc cagttttatc tcggttacat ggatgattac       660
     ggcgcattac gcatgacgac gctcaactgc agcggacaat gccgtttaca agcagtggag       720
     gcgaaatga                                                               729
//

If you have problems or comments...

PBIL Back to PBIL home page