(data stored in ACNUC7421 zone)

EMBL: CP000948.YBGQ

CP000948.YBGQ        Location/Qualifiers
FT   CDS_pept        complement(801537..803984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybgQ"
FT                   /locus_tag="ECDH10B_0785"
FT                   /product="predicted outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0785"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01927"
FT                   /protein_id="ACB01927.1"
FT                   /translation="MNIYRLSFVSCLVMAMPCAMAVEFNLNVLDKSMRDRIDISLLKEK
FT                   GVIAPGEYFVSVAVNNNKISNGQKINWQKKGDKTIPCINDSLVDKFGLKPDIRQSLPQI
FT                   DRCIDFSSRPEMLFNFDQANQQLNISIPQAWLAWHSENWAPPSTWKEGVAGVLMDYNLF
FT                   ASSYRPQDGSSSTNLNAYGTAGINAGAWRLRSDYQLNKTDSEDNHDQSGGISRTYLFRP
FT                   LPQLGSKLTLGETDFSSNIFDGFSYTGAALASDDRMLPWELRGYAPQISGIAQTNATVT
FT                   ISQSGRVIYQKKVPPGPFIIDDLNQSVQGTLDVKVTEEDGRVNNFQVSAASTPFLTRQG
FT                   QVRYKLAAGQPRPSMSHQTENETFFSNEVSWGMLSNTSLYGGLLISDDDYHSAAMGIGQ
FT                   NMLWLGALSFDVTWASSHFDTQQDERGLSYRFNYSKQVDATNSTISLAAYRFSDRHFHS
FT                   YANYLDHKYNDSDAQDEKQTISLSVGQPITPLNLNLYANLLHQTWWNADASTTANITAG
FT                   FNVDIGDWRDISISTSFNTTHYEDKDRDNQIYLSISLPFGNGGRVGYDMQNSSHSTIHR
FT                   MSWNDTLDERNSWGMSAGLQSDRPDNGAQVSGNYQHLSSAGEWDISGTYAASDYSSVSS
FT                   SWSGSFTATQYGAAFHRRSSTNEPRLMVSTDGVADIPVQGNLDYTNHFGIAVVPLISSY
FT                   QPSTVAVNMNDLPDGVTVAENVIKETWIEGAIGYKSLASRSGKDVNVIIRNASGQFPPL
FT                   GADIRQDDSGISVGMVGEEGHAWLSGVAENQLFTVVWGEQSCIIHLPERLEDTTKRLIL
FT                   PCH"
     gtgaatattt atcgactctc ttttgtatcc tgcctggtca tggcgatgcc ttgcgcaatg        60
     gcggtcgaat tcaatctgaa tgttctcgat aaatcaatgc gcgaccgcat tgatatttca       120
     ttattaaagg aaaaaggagt cattgctccc ggtgaatatt ttgttagcgt tgcggtgaat       180
     aacaacaaaa tcagtaatgg gcaaaaaatt aactggcaaa aaaagggtga caaaaccatt       240
     ccatgcatca atgattcact ggtcgataaa tttggtttaa aaccagatat ccgtcagtcc       300
     ttgccacaga tagatcggtg tattgatttc agttcccgac ctgaaatgct cttcaatttc       360
     gatcaagcca atcagcaact gaatattagt attccgcaag cctggctggc gtggcactca       420
     gaaaactggg ctcccccctc tacatggaaa gaaggtgttg ccggtgtcct gatggattac       480
     aacttgtttg ccagcagcta ccgcccacag gacggcagca gcagcactaa cctgaatgcc       540
     tacggtaccg ccggaattaa cgccggggca tggcgcttac gcagtgatta ccagcttaat       600
     aagaccgata gcgaagataa ccatgaccag tcaggcggaa tatcgcgcac ctatcttttt       660
     cgtccattac cgcaattagg ctctaagtta accctcggcg aaaccgattt cagttccaat       720
     attttcgatg gtttttctta taccggcgcg gcactggcga gtgacgatcg aatgttaccg       780
     tgggagctgc gtggctacgc cccacaaatt agcggtattg cacagaccaa tgccacggtg       840
     acgatcagtc aatcaggccg cgtcatttac cagaaaaaag tcccgccagg cccgtttatt       900
     attgatgacc tcaatcagtc tgttcagggc acgctggatg tcaaagtgac ggaagaagat       960
     ggtcgggtga acaatttcca ggtttcggca gcatcgacgc ccttcctgac tcgccaggga      1020
     caggttcgct ataaattggc cgcgggtcag ccacggcctt ccatgtcaca tcaaactgaa      1080
     aatgaaacct tttttagcaa tgaagtttcc tgggggatgc tctcaaacac ctcgctgtac      1140
     ggcggcctgc tgatttctga tgatgactac cattctgccg caatgggtat cgggcaaaat      1200
     atgctgtggc ttggcgcact gtcctttgat gtcacctggg ccagtagcca ttttgatact      1260
     cagcaggacg agcggggctt aagctaccgt tttaattaca gcaaacaagt ggatgccacc      1320
     aacagcacga tttcgctcgc cgcttatcgc ttctcagatc gtcattttca cagctacgcc      1380
     aactatctgg atcacaaata caacgacagc gatgcgcagg acgaaaaaca gacgatcagc      1440
     ttatccgtgg gccaaccgat taccccacta aacctcaatc tttacgccaa cctgctacat      1500
     caaacctggt ggaatgcaga cgcctccacg accgccaaca tcacagcagg ttttaatgtt      1560
     gatattggtg actggagaga tatctcgatt tcgacgtcat tcaatacgac ccactacgaa      1620
     gataaagatc gcgacaacca gatttatctg tcgatttcgc tccccttcgg taacggtggt      1680
     cgggttggct atgacatgca aaacagtagc cacagcacca tacaccgcat gtcgtggaac      1740
     gatacgctgg atgaacgtaa tagctggggc atgtctgccg gactgcaatc cgatcgtccg      1800
     gacaatggag cccaggtgag cggtaactat cagcacctga gttcagcggg tgagtgggat      1860
     atttctggta cctatgccgc cagtgattac agttccgtca gcagcagctg gagcggttct      1920
     ttcaccgcaa cccaatatgg tgcagcattt catcgccgca gctccaccaa tgaaccacgc      1980
     ctgatggtca gcaccgatgg cgtggcagat attccggttc agggcaatct cgactacacc      2040
     aaccattttg gcattgcggt ggtgccgttg atttccagtt accagccttc caccgtggcg      2100
     gtgaacatga atgacttacc cgacggcgta acagttgcag aaaacgtcat caaggaaaca      2160
     tggattgaag gcgcgatagg ttacaaatca ctggcttccc gttccggtaa agacgttaac      2220
     gtcatcatac gcaacgccag cggtcagttc cctcccctcg gtgcggatat ccgccaggat      2280
     gacagcggca ttagcgtggg tatggttggc gaggaaggac atgcctggtt aagcggtgtc      2340
     gctgaaaatc aactgtttac cgtggtctgg ggtgagcaaa gctgcattat tcatctgcca      2400
     gaacgtctgg aagacacgac caaacgcctg attttacctt gtcattaa                   2448
//

If you have problems or comments...

PBIL Back to PBIL home page