(data stored in ACNUC7421 zone)

EMBL: CP000948.YKFA

CP000948.YKFA        Location/Qualifiers
FT   CDS_pept        complement(241425..242288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykfA"
FT                   /locus_tag="ECDH10B_0238"
FT                   /product="CP4-6 prophage; predicted GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01420"
FT                   /protein_id="ACB01420.1"
FT                   /translation="MNNSEGLKSFQQSLADLPQWVSERLLQQINQLTNYEPVIGIMGKT
FT                   GVGKSSLCNALFAGDISPVSDVAACTREPLRFRLQVGDRYITLMDLPGVGESGARDTEY
FT                   AALYREQLPRLDLVLWLIKADDRALTVDEHFYHQVIGEVYRHKVLFVISQSDKAEPTSG
FT                   GGQLSTAQKQNISRKICLLHELFQPVHPVCAVSVRLQWGLKVMAERMIKCLPREATSPV
FT                   VSQLHPSFRTTVVREQARSDFGETVGAVLDSISAFPLIPAPVRAVIQAVRTTVVSVARA
FT                   VWDFFF"
     atgaataatt ctgaaggttt gaagtcgttt cagcaatcgc ttgctgatct gccgcaatgg        60
     gtatcagagc ggcttctgca gcaaattaac cagttaacta actacgagcc agtgatcggc       120
     attatgggta aaaccggtgt tgggaagagc agtctgtgca atgccctgtt tgccggagat       180
     atatcaccgg tcagcgatgt ggcggcctgt acacgtgagc cactgcgctt tcgcctgcaa       240
     gtcggcgacc gctatataac gctgatggat ctgcccggcg tgggcgaaag tggcgctcgc       300
     gataccgagt atgctgcgct gtaccgcgaa cagcttcctc gcctcgacct ggtactgtgg       360
     ctgattaagg ccgatgaccg ggcgctgacg gtggatgaac atttttatca tcaggtgatt       420
     ggagaggtat accggcataa ggtgctgttt gttatcagcc agtcggataa ggccgaacct       480
     accagcggtg ggggacagtt gtccacggcg cagaagcaga atatcagccg caaaatctgc       540
     ctgctgcatg agctgttcca gcccgtccat ccggtgtgtg ctgtgtcggt ccgtctacaa       600
     tgggggctta aggtgatggc cgagcggatg attaagtgcc tgccacgtga ggccaccagc       660
     ccggtggtgt cgcaactcca tccttccttt cgcacgacgg tagtccggga acaggctcgt       720
     agcgattttg gtgaaaccgt cggggccgta ctcgatagca tcagtgcctt tcccctgata       780
     cccgccccgg tgcgggccgt cattcaggcc gtgcgcacca cggtggtgtc agtggcccgc       840
     gccgtctggg atttcttctt ctga                                              864
//

If you have problems or comments...

PBIL Back to PBIL home page