(data stored in ACNUC7421 zone)

EMBL: CP000948.YKFF

CP000948.YKFF        Location/Qualifiers
FT   CDS_pept        complement(238632..238871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykfF"
FT                   /locus_tag="ECDH10B_0232"
FT                   /product="CP4-6 prophage; predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01416"
FT                   /protein_id="ACB01416.1"
FT                   /translation="MTQSVLLPPGPFTRRQAQAVTTTYSNITLEDDQGSHFRLVVRDTE
FT                   GRMVWRAWNFEPDAGEGLNRYIRTSGIRTDTATR"
     atgacccaat ccgtgttgct gccaccgggg cctttcaccc ggagacaagc gcaagcggtc        60
     actaccacgt acagcaatat cacactcgaa gacgaccagg gcagtcactt ccgtctggtg       120
     gttcgtgata ctgaaggccg gatggtctgg cgggcatgga actttgagcc ggatgccggt       180
     gaaggtctta accgctatat ccgcacctca ggcatccgta cagacacggc cacccgctga       240
//

If you have problems or comments...

PBIL Back to PBIL home page