(data stored in ACNUC7421 zone)

EMBL: CP000948.YKFG

CP000948.YKFG        Location/Qualifiers
FT   CDS_pept        complement(237584..238060)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykfG"
FT                   /locus_tag="ECDH10B_0230"
FT                   /product="CP4-6 prophage; predicted DNA repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01414"
FT                   /protein_id="ACB01414.1"
FT                   /translation="MKQLSFLPGEMTPQDRRLIQRALRALDRHLHEPGVAFTSTHAVRE
FT                   WLRLHMAALEREEFRVLYLDNQNQLIAHETLFTGTINRTEVHPREVVKRALHFNAAAVI
FT                   LAHNHPSGETTPSQADKTLTQRLVQVLQLVDIRVPDHLIVGGRQIYSFAEHGLL"
     atgaaacagc tttccttttt acccggcgag atgacgccac aggaccggcg tctcattcag        60
     cgggcgctca gggctctgga ccgccacctg catgagcccg gcgtagcctt cacctctacc       120
     cacgccgtac gtgaatggct gcgactgcat atggccgcgc ttgagcggga agagttccgg       180
     gtgttgtatc tggacaacca gaatcagttg attgcccatg aaacgctctt caccggcacg       240
     attaaccgca ccgaggtgca tccccgggag gtggtcaaac gtgctctgca cttcaacgcg       300
     gcggcggtga tactcgcgca taaccatcct tccggcgaga cgacacctag ccaggccgac       360
     aaaaccctca cgcagcgact ggttcaggtg cttcagctgg tggatatccg tgtccctgac       420
     catctgattg tcggtggcag gcaaatctat tcgttcgcag aacacggtct gctttga          477
//

If you have problems or comments...

PBIL Back to PBIL home page