(data stored in ACNUC7421 zone)

EMBL: CP000948.YKFH

CP000948.YKFH        Location/Qualifiers
FT   CDS_pept        complement(237354..237575)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykfH"
FT                   /locus_tag="ECDH10B_0229"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01413"
FT                   /protein_id="ACB01413.1"
FT                   /translation="MKIISKRRAMTIYRQHPESRIFRYCTGKYQWHGSVCHYTGRDVPD
FT                   IAGVLAVYAERRQDRNGPYTCLMSITLN"
     atgaaaatta tcagtaaacg cagggcaatg acgatatacc gccagcatcc tgagtcccga        60
     atctttcgct actgcaccgg caaataccag tggcacggta gcgtctgtca ttacaccggc       120
     agggacgttc cggatatcgc cggagtcctc gcggtatacg ccgaacgccg ccaggaccgc       180
     aatgggccct atacctgcct gatgagcatc accctgaact ga                          222
//

If you have problems or comments...

PBIL Back to PBIL home page