(data stored in ACNUC7421 zone)

EMBL: CP000948.YKGB

CP000948.YKGB        Location/Qualifiers
FT   CDS_pept        complement(292500..293093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykgB"
FT                   /locus_tag="ECDH10B_0290"
FT                   /product="conserved inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01468"
FT                   /protein_id="ACB01468.1"
FT                   /translation="MEKYLHLLSRGDKIGLTLIRLSIAIVFMWIGLLKFVPYEADSITP
FT                   FVANSPLMSFFYEHPEDYKQYLTHEGEYKPEARAWQTANNTYGFSNGLGVVEVIIALLV
FT                   LANPVNRWLGLLGGLMAFTTPLVTLSFLITTPEAWVPALGDAHHGFPYLSGAGRLVLKD
FT                   TLMLAGAVMIMADSAREILKQRSNESSSTLKTEY"
     atggaaaaat acctgcacct gttaagtcgg ggagataaaa ttggcctgac attgattcgt        60
     ctgagtattg caattgtttt tatgtggatt gggttattaa agtttgtccc ttacgaggca       120
     gacagcatta caccattcgt cgcaaacagt ccactaatgt cgttctttta tgaacacccg       180
     gaagactata aacagtatct gactcacgaa ggcgaataca aaccagaagc aagggcatgg       240
     caaacggcca ataataccta tggtttttcc aacggtcttg gcgtcgtgga ggtgattatt       300
     gctctgctgg ttttggctaa tcctgtcaat cgctggttag gtttattggg aggactgatg       360
     gcatttacca cgccgctggt aacactctca tttttaatca ccaccccgga ggcatgggta       420
     cccgcattgg gtgacgctca tcatggtttc ccttatttat ccggtgctgg tcgcctggta       480
     ttgaaagata ctctgatgct ggcaggtgca gtcatgataa tggcagattc ggcgcgggaa       540
     attcttaaac aacgcagtaa tgaatccagt tcaacgttaa aaactgaata ttga             594
//

If you have problems or comments...

PBIL Back to PBIL home page