(data stored in ACNUC7421 zone)

EMBL: CP000948.YKGI

CP000948.YKGI        Location/Qualifiers
FT   CDS_pept        complement(293105..293341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykgI"
FT                   /locus_tag="ECDH10B_0291"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01469"
FT                   /protein_id="ACB01469.1"
FT                   /translation="MFKKSVLFATLLSGVMAFSTNADDKIILKHISVSSVSASPTVLED
FT                   TIADIARKYNASSWKVTSMRIDNNSTATAVLYK"
     atgtttaaaa aatctgtttt atttgcaaca ctattatctg gcgttatggc attttccacc        60
     aatgcagatg ataaaataat tctgaaacat atcagcgtct cgtcagtatc agcatcaccg       120
     acagttctgg aggataccat tgctgatata gccagaaaat ataatgcttc atcctggaaa       180
     gtcacatcga tgcgaattga taataattca accgcaacag cagtattgta taaataa          237
//

If you have problems or comments...

PBIL Back to PBIL home page