(data stored in ACNUC7421 zone)

EMBL: CP000948.YKGN

CP000948.YKGN        Location/Qualifiers
FT   CDS_pept        complement(253352..253690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykgN"
FT                   /locus_tag="ECDH10B_0252"
FT                   /product="predicted IS protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01432"
FT                   /protein_id="ACB01432.1"
FT                   /translation="MSGKRYPEEFKTEAVKQVVDLGYSVASVATRLDITTHSLYAWIKK
FT                   YGPDSSTNKEQSDAQAEIRRLQKELKRVTDERDILKKAAVDSICQCNTPFNYLFRCFEL
FT                   QCLSRSVV"
     atgagcggta agcgttatcc cgaagagttt aaaactgaag cagtcaaaca ggttgttgat        60
     ctcggttatt ctgttgccag cgttgcaaca cgtctcgata tcaccaccca cagcctttat       120
     gcctggataa agaagtacgg tccggattct tccactaata aagaacagtc agatgctcag       180
     gccgagatcc gccgtctcca gaaagagctg aaacgggtta ccgacgaacg ggacatatta       240
     aaaaaagctg ctgtagattc aatctgtcaa tgcaacaccc ctttcaatta tctctttcgg       300
     tgttttgaac ttcagtgtct ttctcggtct gttgtttag                              339
//

If you have problems or comments...

PBIL Back to PBIL home page