(data stored in ACNUC7421 zone)

EMBL: CP000948.YKIB

CP000948.YKIB        Location/Qualifiers
FT   CDS_pept        complement(328452..328721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykiB"
FT                   /locus_tag="ECDH10B_0326"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01501"
FT                   /protein_id="ACB01501.1"
FT                   /translation="MLRYRRMVQLFFPLSPNVDIYNLWRKTRIKFIKAQYFNMLQIILF
FT                   LKHTHNKYHKHKPDKYPMNMQQSFNYSIYSSATKLQKIITNSYK"
     atgctgcgtt acagacgaat ggttcaatta ttctttcccc taagtccgaa tgtggacata        60
     tataatttat ggagaaaaac acgcatcaaa ttcataaaag cacagtattt caacatgttg       120
     cagataattt tgtttttgaa gcatacgcat aataaatatc acaaacacaa accagataaa       180
     tatcctatga atatgcaaca aagttttaat tattcaattt atagcagcgc aaccaaactc       240
     caaaaaataa taaccaacag ctataaataa                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page