(data stored in ACNUC7421 zone)

EMBL: CP000948.YLAB

CP000948.YLAB        Location/Qualifiers
FT   CDS_pept        complement(415622..417172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ylaB"
FT                   /locus_tag="ECDH10B_0413"
FT                   /product="conserved inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01584"
FT                   /protein_id="ACB01584.1"
FT                   /translation="MRTRHLVGLISGVLILSVLLPVGLSIWLAHQQVETSFIEELDTYS
FT                   SRVAIRANKVATQGKDALQELERWQGAACSEAHLMEMRRVSYSYRYIQEVAYIDNNVPQ
FT                   CSSLEHESPPDTFPEPGKISKDGYRVWLTSHNDLGIIRYMVAMGTAHYVVMIDPASFID
FT                   VIPYSSWQIDAAIIGNAHNVVITSSDEIAQGIITRLQKTPGEHIENNGIIYDILPLPEM
FT                   NISIITWASTKMLQKGWHRQVFIWLPLGLVIGLLAAMFVLRILRRIQSPHHRLQDAIEN
FT                   RDICVHYQPIVSLANGKIVGAEALARWPQTDGSWLSPDSFIPLAQQTGLSEPLTLLIIR
FT                   SVFEDMGDWLRQHPQQHISINLESPVLTSEKIPQLLRDMINHYQVNPRQIALELTEREF
FT                   ADPKTSAPIISRYREAGHEIYLDDFGTGYSSLSYLQDLDVDILKIDKSFVDALEYKNVT
FT                   PHIIEMAKTLKLKMVAEGIETSKQEEWLRQHGVHYGQGWLYSKALPKEDFLRWAEQHL"
     gtgagaacac gacatctggt cggccttatt tcgggagtac tgattctttc agtattgctg        60
     cctgtcggct taagcatctg gctggcccat cagcaggtag aaacatcgtt tattgaagag       120
     ctggatacct attcctcccg cgtcgctatt cgagccaata aggtggcgac acaagggaaa       180
     gatgcgctgc aggagctgga aagatggcaa ggcgctgcct gtagcgaagc ccatctcatg       240
     gaaatgcgtc gggtatctta cagttatcgc tatattcagg aagtggctta tatcgataac       300
     aacgttcccc agtgttcgtc tctggagcat gaaagtccgc ccgatacctt ccccgagcca       360
     ggtaaaattt cgaaagatgg ttatcgtgtc tggttaacat cgcataacga tttaggcatt       420
     atccgttaca tggtcgccat gggaacggca cattatgtcg tcatgatcga ccccgcttcc       480
     tttattgatg tcattcccta tagctcatgg caaattgatg ccgccattat tggcaatgcc       540
     cataacgttg tcataaccag cagcgatgaa attgctcagg gaattattac caggctacaa       600
     aaaacacccg gtgagcatat cgaaaataat ggaatcattt acgatatcct gcccttaccg       660
     gagatgaata tttcgatcat cacatgggct tcaacgaaaa tgttgcagaa aggctggcat       720
     cggcaagtct ttatttggtt accgctcggg ttggtgattg gcctgctggc agcgatgttt       780
     gtgctgcgta ttttgcgccg tattcagtca ccgcatcatc ggctgcagga tgctatcgaa       840
     aatcgtgata tttgcgtgca ctatcagccg attgtctcct tagccaatgg caaaattgtc       900
     ggtgctgagg cactggcgcg ctggccgcag acagacggta gttggttgtc accagatagt       960
     tttattccgc tggcacagca aacgggcctt tctgagccat tgacgctact gattataaga      1020
     agcgtctttg aagatatggg cgactggctg cgtcagcatc cacagcagca tatttcgatc      1080
     aatcttgaat cccccgtgct cacctcggaa aaaatcccgc aattgctgcg tgacatgatc      1140
     aatcactatc aggttaatcc cagacagatc gcgcttgaac tcactgaacg cgagtttgcc      1200
     gatccgaaaa ccagcgcccc gataatttct cgctaccggg aggcgggcca tgaaatttat      1260
     cttgatgatt ttggtacggg gtattcaagt ttaagttatt tacaggatct ggatgtcgac      1320
     attctgaaga tcgataaatc tttcgttgat gcgctggaat ataaaaatgt cacgccgcat      1380
     atcatcgaaa tggcaaaaac actgaaactg aaaatggtag cggagggaat cgaaaccagt      1440
     aaacaagaag agtggttacg ccagcatggc gtgcactacg gtcagggctg gctctacagc      1500
     aaggcattac cgaaagaaga tttcttacgc tgggccgagc aacatttgtg a               1551
//

If you have problems or comments...

PBIL Back to PBIL home page