(data stored in ACNUC7421 zone)

EMBL: CP000948.YLBA

CP000948.YLBA        Location/Qualifiers
FT   CDS_pept        complement(481816..482601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ylbA"
FT                   /locus_tag="ECDH10B_0471"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01640"
FT                   /protein_id="ACB01640.1"
FT                   /translation="MGYLNNVTGYREDLLANRAIVKHGNFALLTPDGLVKNIIPGFENC
FT                   DATILSTPKLGASFVDYLVTLHQNGGNQQGFGGEGIETFLYVISGNITAKAEGKTFALS
FT                   EGGYLYCPPGSLMTFVNAQAEDSQIFLYKRRYVPVEGYAPWLVSGNASELERIHYEGMD
FT                   DVILLDFLPKELGFDMNMHILSFAPGASHGYIETHVQEHGAYILSGQGVYNLDNNWIPV
FT                   KKGDYIFMGAYSLQAGYGVGRGEAFSYIYSKDCNRDVEI"
     atgggatatt taaataacgt caccggttac cgcgaagatt tactggctaa ccgtgcgatt        60
     gttaaacacg gtaatttcgc actgttaacc ccggatggtc tggtaaaaaa tattattccg       120
     ggctttgaaa attgtgacgc gacaatcctc tccacgccaa agctgggtgc ctcttttgtt       180
     gattatctgg tcacactgca tcaaaacggt ggcaaccaac agggcttcgg tggcgaaggc       240
     attgaaacgt tcctgtatgt gatctctgga aatatcactg ccaaagccga aggcaaaaca       300
     tttgccttaa gcgaaggtgg ctatctttat tgcccgccag gctccttaat gacgtttgtt       360
     aacgcccagg ccgaagacag ccaaatcttt ttatataagc gccgctatgt tccggtagaa       420
     ggctatgcac cgtggctggt ttctggcaat gccagcgaac tggaacgcat tcattatgaa       480
     ggcatggacg atgttattct gctggatttt ctgcccaaag agttaggttt tgatatgaac       540
     atgcatatcc tctcttttgc accaggtgcc agccacggtt atatcgaaac acacgttcag       600
     gaacacggtg cctatattct ttccggtcag ggggtttata acctcgacaa taactggatc       660
     ccggtgaaaa aaggcgatta catctttatg ggcgcttatt ctttacaggc tggttatggt       720
     gtagggcgtg gtgaagcgtt cagctatatt tactcgaaag attgtaaccg cgacgtagag       780
     atttaa                                                                  786
//

If you have problems or comments...

PBIL Back to PBIL home page