(data stored in ACNUC7421 zone)

EMBL: CP000948.YLBF

CP000948.YLBF        Location/Qualifiers
FT   CDS_pept        488182..488997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ylbF"
FT                   /locus_tag="ECDH10B_0476"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01645"
FT                   /protein_id="ACB01645.1"
FT                   /translation="MTIIHPLLASSSAPNYRQSWRLAGVWRRAINLMTESGELLTLHRQ
FT                   GSGFGPGGWVLRRAQFDALCGGLCGNERPQVVAQGIRLGRFTVKQPQRYCLLRITPPAH
FT                   PQPLAAAWMQRAEETGLFGPLALAASDPLPAELRQFRHCFQAALNGVKTDWRHWLGKGP
FT                   GLTPSHDDTLSGMLLAAWYYGALDARSGRPFFACSDNLQLVTTAVSVSYLRYAAQGYFA
FT                   SPLLHFVHALSCPKRTAVAIDSLLALGHTSGADTLLGFWLGQQLLQGKP"
     atgacgatca tccatcctct gcttgccagt agtagcgcac cgaattatcg ccagtcctgg        60
     cggttagcgg gagtgtggcg gcgggcgatt aacctgatga cggaaagcgg cgaactgtta       120
     acgttgcatc gtcagggtag tggtttcggc cccggaggat gggtgcttcg ccgtgcgcaa       180
     ttcgatgcgt tatgcggtgg attatgcggc aatgaacgac cacaggttgt ggctcaaggg       240
     attcgcctcg ggcgtttcac ggttaaacag ccacagcgtt attgtttgct gcgtattacg       300
     ccgcctgcgc atcctcaacc acttgcagct gcatggatgc aacgcgcgga ggaaaccggg       360
     cttttcgggc cactggcgtt ggcggcaagc gatccgctgc ctgctgagtt acgccagttt       420
     cgtcactgtt ttcaggccgc gctcaatggc gttaagaccg actggcggca ctggctgggt       480
     aaaggccccg gattaacgcc gagtcatgat gacacgctga gcggaatgct gctggcggcc       540
     tggtattatg gcgctttaga tgcgcgctcc ggtcgtccgt tttttgcctg ttccgacaat       600
     ctgcaactcg ttaccacagc ggtgagcgtc agttatttac gttatgccgc gcaaggatat       660
     ttcgcctcgc cactcctgca ctttgttcat gctctgagtt gcccgaaacg taccgctgtt       720
     gcgattgatt cgctgctggc gctggggcat acgtcagggg cagatacgct gctggggttc       780
     tggcttggcc aacaattatt acaaggaaaa ccatga                                 816
//

If you have problems or comments...

PBIL Back to PBIL home page