(data stored in ACNUC7421 zone)

EMBL: CP000948.YLBH

CP000948.YLBH        Location/Qualifiers
FT   CDS_pept        466504..467214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ylbH"
FT                   /locus_tag="ECDH10B_0456"
FT                   /product="conserved protein, rhs-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01626"
FT                   /protein_id="ACB01626.1"
FT                   /translation="MLALMDADGNIAWSGEYDEWGNQLNEENPHHLHQPYRLPGQQYDK
FT                   ESGLYYNRNRYYDPLQGRYITQDPIGLEGGWSLYAYPLNPVNGIDPLGLSPADVALIRR
FT                   KDQLNHQRAWDILSDTYEDMKRLNLGGTDQFFHCMAFCRVSKLNDAGVSRSAKGLGYEK
FT                   EIRDYGLNLFGMYGRKVKLSHSEMIEDNKKDLAVNDHGLTCPSTTDCSDRCSDYINPEH
FT                   KKTIKALQDAGYLK"
     atgctggcgc tgatggatgc ggatggaaac attgcgtgga gcggggagta tgatgagtgg        60
     ggcaaccagc tgaatgaaga gaacccgcat cacctgcacc agccgtaccg gctgccgggg       120
     cagcagtatg ataaggagtc ggggctgtac tacaaccgga accggtacta cgatccgttg       180
     caggggcggt atatcactca ggacccgata gggctggagg ggggatggag tctgtatgcg       240
     tatccgctga atccggtgaa tggtattgat ccattagggt taagtcccgc agatgtagcg       300
     ctaataagaa gaaaagatca actaaaccat caaagagcat gggatatatt atctgatact       360
     tatgaagata tgaagagatt aaatttaggt gggactgatc aatttttcca ttgtatggca       420
     ttttgtcgag tgtctaaatt aaatgacgct ggtgttagcc gatcggcgaa agggctgggt       480
     tatgaaaaag agattagaga ttacgggtta aatctgttcg gtatgtacgg cagaaaagta       540
     aagctatccc attctgaaat gattgaagat aataaaaaag acttggctgt aaatgaccat       600
     gggttgacat gtccatcaac aacagattgc tcagatagat gtagtgatta tattaatcca       660
     gagcataaaa aaacgataaa ggctttacaa gatgctggct atctcaagta a                711
//

If you have problems or comments...

PBIL Back to PBIL home page