(data stored in ACNUC1104 zone)

EMBL: CP000959.PE1

CP000959.PE1         Location/Qualifiers
FT   CDS_pept        complement(29..481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3185"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: psb:Psyr_4042 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3185"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92342"
FT                   /db_xref="InterPro:IPR032032"
FT                   /db_xref="InterPro:IPR038314"
FT                   /db_xref="UniProtKB/TrEMBL:B1K862"
FT                   /protein_id="ACA92342.1"
FT                   /translation="MRGVRIAAALACIAFQPAMVVAKDAARAAPEAGSRTYLQNFKDLV
FT                   LAECLATAYKQAPGVSKDIGSSASALRDWTYYDMERAPDVIHALVAKYLARDYRNPVVE
FT                   SEVADVKFDFLKCIDLYHGKELDAAAKQFVSRPNRTYRTEHPPTPH"
     atgaggggag tccggatcgc cgccgcgttg gcgtgcatcg cgtttcaacc ggcgatggtc        60
     gtggcgaagg atgccgcacg agcggcgcct gaggcaggct cacgaactta tctccagaac       120
     ttcaaggacc tggtgctcgc ggagtgcctg gctaccgcat acaagcaggc gcccggcgtg       180
     agcaaggaca tcggcagcag cgccagcgcg ttgcgcgact ggacctacta cgacatggaa       240
     cgtgcgccgg acgtcattca cgcgctggtc gcgaagtatc tggctcgcga ctatcggaat       300
     ccggtcgtcg aatcggaagt cgcggacgtg aagttcgact tcctgaagtg cattgatctg       360
     tatcacggca aggaactgga cgctgcagcg aagcaattcg tatcgcgccc gaaccgtacc       420
     taccggaccg agcatccgcc gacgcctcat tag                                    453
//

If you have problems or comments...

PBIL Back to PBIL home page