(data stored in ACNUC1104 zone)

EMBL: CP000959.PE100

CP000959.PE100       Location/Qualifiers
FT   CDS_pept        complement(114151..114915)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3285"
FT                   /product="4-hydroxyphenylacetate degradation bifunctional
FT                   isomerase/decarboxylase,HpaG2 subunit"
FT                   /EC_number="4.1.1.68"
FT                   /note="KEGG: bur:Bcep18194_B1782
FT                   5-carboxymethyl-2-hydroxymuconate delta-isomerase; TIGRFAM:
FT                   4-hydroxyphenylacetate degradation bifunctional
FT                   isomerase/decarboxylase,HpaG2 subunit; PFAM:
FT                   fumarylacetoacetate (FAA) hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3285"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92441"
FT                   /db_xref="GOA:B1K8U4"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR012684"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:B1K8U4"
FT                   /protein_id="ACA92441.1"
FT                   /translation="MKTARVIYNGALHAAEPAGDGAIRLDTGSMVAEDAVAWLPPVAPR
FT                   TTFALGLNYADHAKELAFNAPSEPLIFLKGPNTFVGHRSLTVRPADATHMHYECELAVV
FT                   IGRPARHVSRAQAIDYVAGYTVANDYAIRDYLENYYRPNLRVKNRDTCTPLGPWFVSRD
FT                   EIGDAGDLTLRTTVNGRETQRGSTRDMVFDVPALIEHISSFMTLSPGDLILTGTPEGLA
FT                   DTKPGDEVVTEIEGIGRLVNTIVGEADYYRAG"
     atgaagacgg cgcgcgtgat ctacaacggc gcactgcatg cggccgaacc ggccggcgac        60
     ggcgcgatcc gcctcgatac gggcagcatg gtggccgagg acgcggtggc gtggctgccg       120
     cccgtcgcgc cgcgcacgac gttcgcgctc ggcctgaact acgccgacca tgcgaaggag       180
     ctcgcgttca acgcgccgag cgaaccgctg attttcctga aggggccgaa tacgttcgtc       240
     ggccaccggt cgctgaccgt gcgccccgcg gacgccacgc acatgcacta cgagtgcgaa       300
     ctggccgtcg tgatcggccg gcccgcgcgc cacgtgagcc gcgcgcaggc catcgactac       360
     gtggccggct atacggtcgc gaacgactac gcgatccgcg actatctcga aaactactac       420
     cgcccgaacc tgcgcgtgaa gaaccgcgac acctgcacgc cgctcgggcc gtggttcgtc       480
     agccgcgacg agatcggcga cgcgggcgac ctgacgctgc gcacgacggt gaacggccgg       540
     gagacgcagc gcggcagcac gcgcgacatg gtgttcgacg tgcctgcgct gatcgagcac       600
     atcagcagct tcatgacgct ctcgccgggc gacctgatcc tgaccggcac gcccgagggg       660
     ctggcggaca cgaagccggg cgacgaggtc gtgaccgaaa tcgaaggaat cggccggctc       720
     gtgaacacga tcgtcggcga ggcagactac tatcgcgccg gctga                       765
//

If you have problems or comments...

PBIL Back to PBIL home page