(data stored in ACNUC1104 zone)

EMBL: CP000959.PE101

CP000959.PE101       Location/Qualifiers
FT   CDS_pept        complement(114912..115601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3286"
FT                   /product="4-hydroxyphenylacetate degradation bifunctional
FT                   isomerase/decarboxylase, HpaG1 subunit"
FT                   /EC_number="4.1.1.68"
FT                   /note="KEGG: bam:Bamb_3653 4-hydroxyphenylacetate
FT                   degradation bifunctional isomerase/decarboxylase, HpaG1
FT                   subunit; TIGRFAM: 4-hydroxyphenylacetate degradation
FT                   bifunctional isomerase/decarboxylase, HpaG1 subunit; PFAM:
FT                   fumarylacetoacetate (FAA) hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3286"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92442"
FT                   /db_xref="GOA:B1K8U5"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR012686"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:B1K8U5"
FT                   /protein_id="ACA92442.1"
FT                   /translation="MELSCTTAAAPPLPVAIGTVYGALLNERAALDALGDAVNAPPYGR
FT                   PPQAPILYIKSANTHAADGAAVIVPAGVDALEIGASVAVVFARRATRVPAARALDYVHG
FT                   FTLASDVSVPHPDYYRPAVRFKCRDGFCPLGPTIVPAAALADVDAIGLTVRIDGEVAAS
FT                   ASTATLIRPVRALIADVTAFMSFDAGDVLLLGVAGGAPRARAGSTIEIAAAGIGTLRHT
FT                   LTAEDAR"
     atggagctgt cttgcacgac cgccgcggcg ccgccgttgc cggtcgccat cggtaccgtc        60
     tacggggcct tgctcaacga gcgcgcggcg ctcgacgcgc tcggcgatgc ggtgaacgca       120
     ccgccttacg gccgcccgcc gcaggcgccg atcctgtaca tcaaatccgc caacacgcat       180
     gcagccgacg gcgccgccgt gatcgtgccg gccggtgtcg acgcgctgga gatcggcgcg       240
     tcggtggccg tcgtgttcgc gcggcgcgcg acgcgcgtgc cggccgcgcg ggcgctcgac       300
     tacgtgcacg gcttcacgct cgcgagcgac gtgtcggtgc cgcatcccga ttactaccgt       360
     ccggccgtgc gcttcaagtg ccgcgacggc ttctgcccgc ttgggcccac gatcgtgccg       420
     gccgccgcgc tcgccgatgt cgacgcgatc ggcctgacgg tgcggatcga cggcgaagtg       480
     gcggcatccg cgtcgaccgc gacgctgatt cgcccggtgc gcgcgctgat cgccgacgtg       540
     acggccttca tgtcgttcga cgcgggcgac gtgctgttgc tcggcgtcgc gggcggcgcg       600
     ccgcgtgccc gcgcgggcag cacgatcgag atcgccgcgg ccggcatcgg cacgttgcgg       660
     catacgctga cggcggagga cgcacgatga                                        690
//

If you have problems or comments...

PBIL Back to PBIL home page