(data stored in ACNUC1104 zone)

EMBL: CP000959.PE102

CP000959.PE102       Location/Qualifiers
FT   CDS_pept        115754..116194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3287"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="TIGRFAM: homoprotocatechuate degradation operon
FT                   regulator, HpaR; PFAM: regulatory protein MarR; KEGG:
FT                   bur:Bcep18194_B1784 transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3287"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92443"
FT                   /db_xref="GOA:B1K8U6"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR012712"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B1K8U6"
FT                   /protein_id="ACA92443.1"
FT                   /translation="MNRTLDHRNLAMLLLEARETLMGLFRPILKEFSLTEQQWRIIRVL
FT                   DGEPTEALEAGQIAKRCCILSPSLTGVLERMERDGLITRTRAQEDQRRLLVSLTPQSRK
FT                   LVTEIGPRIDAQYRQLESRFGQDGLEDIYRALDRLIELGSQA"
     atgaaccgta cgctcgacca tcgcaacctg gccatgctgc tgctcgaggc ccgcgaaacg        60
     ctgatgggtc tgtttcgccc cattctcaag gaattttcgc tgaccgaaca gcaatggcgg       120
     atcatccgcg tgctcgacgg cgaaccgacg gaggcgctcg aagccggaca gatcgcgaaa       180
     cgctgctgca tcctgagccc gagcctgact ggcgtgctgg agcggatgga gcgcgacggc       240
     ctgatcacgc gcacgcgcgc gcaggaggat cagcgccggc tgctggtcag cctgacgccg       300
     caaagcagga aactggtgac ggagatcggg ccgcgcatcg acgcgcaata tcgtcagctc       360
     gagtcgcggt tcggccagga cggcctggaa gacatctacc gcgcgctcga ccggctcatc       420
     gagctcggca gccaggcgta a                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page