(data stored in ACNUC1104 zone)

EMBL: CP000959.PE103

CP000959.PE103       Location/Qualifiers
FT   CDS_pept        complement(116270..117484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3288"
FT                   /product="Male sterility domain"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; Male
FT                   sterility domain; KEGG: bur:Bcep18194_B1785 NAD-dependent
FT                   epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3288"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92444"
FT                   /db_xref="InterPro:IPR013120"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B1K8U7"
FT                   /protein_id="ACA92444.1"
FT                   /translation="MLIWKTALSLNWRTSLVSPASAPVAAANVGRLVLTGATGFIGSTV
FT                   LTALVNAGLLERIVCVVRAQDRGHAVARLREAALRAGLAPYWASRLTDANVIVGALGDV
FT                   WHGADAPRLAGATHVIHCAGHASPADGAHLQADIADAVHFAERFARAPRLQRFVYVGTA
FT                   YAHAGRGGIVQEEAERDAENDVAPQADEGLPGAVLAADYLHAKARTEQRLRALGLPLVV
FT                   VRPSHVVGHTVLGTRPAPNSFWMFRLAHAARRFTARPMTRIDIVSVDDVARATMLLAVK
FT                   PTLAHDVYHVSAGDEAPQVAQIVRAMDEAAGMTGAPRYAACAPAELPLVVRDVLGRPDP
FT                   ALERVIGRALQRCGEFATVDRVFDNRRVRDEIDFEPLPFIDYVEECMRTSRGVAVTELM
FT                   RGAIH"
     gtgctgatct ggaaaaccgc gttgtcgctc aactggcgga cgagcctcgt gtcgccggcc        60
     agcgcaccgg tcgcggcggc gaacgtgggc cggctggtgc tgaccggcgc gaccggcttc       120
     atcggcagta ccgtgctgac ggcgctcgtc aatgcggggc tgctcgaacg catcgtgtgc       180
     gtcgtgcgcg cgcaggaccg cggccatgcg gtcgcgcggc tgcgggaagc ggcgttgcgc       240
     gcggggctcg cgccgtactg ggcgtcgcgc ctgaccgatg cgaacgtgat cgtcggtgcg       300
     ctcggcgacg tgtggcacgg cgccgatgcg ccgcgcctgg ccggcgcgac gcacgtgatt       360
     cactgcgcgg gccatgcgtc gccggccgac ggcgcgcatc tgcaggccga catcgccgac       420
     gcggtgcact tcgctgaacg ctttgcccgc gcgccgcgcc tgcagcgctt cgtgtacgtc       480
     ggcacggcct acgcgcatgc gggccgcggc gggatcgtgc aggaagaggc ggaacgcgac       540
     gcggagaacg acgtcgcgcc gcaggccgac gaaggcctgc ccggcgcggt gctggcggcc       600
     gactacctgc atgcgaaggc ccggacggag cagcgtctgc gcgcgctcgg gctgccgctc       660
     gtcgtcgtgc ggccgtcgca cgtggtcggc catacggtgc tcgggacgcg gcccgcaccg       720
     aattcgttct ggatgttccg gctcgcgcat gcggcgcgcc gcttcaccgc gcggccgatg       780
     acgcgcatcg acatcgtgtc ggtggacgac gtggcgcgcg cgacgatgct gctggccgtc       840
     aagccgacgc tggcgcacga cgtctatcac gtgtcggccg gcgacgaggc gccgcaggtc       900
     gcgcagatcg tgcgcgcgat ggacgaggcg gcgggaatga ccggtgcgcc gcgctacgcg       960
     gcgtgcgcgc cggcggaact gccgctcgtc gtgcgtgatg tgctggggcg ccccgatccg      1020
     gcactcgagc gtgtgatcgg ccgggccctg cagcgctgcg gggaattcgc gacggtcgat      1080
     cgcgtgttcg acaatcgccg cgtgcgcgac gaaatcgact tcgagccatt gccgttcatc      1140
     gattacgtcg aggagtgcat gcgcacgtcg cgcggcgtgg ccgtgaccga gctgatgcgc      1200
     ggcgcgatcc actga                                                       1215
//

If you have problems or comments...

PBIL Back to PBIL home page