(data stored in ACNUC1104 zone)

EMBL: CP000959.PE104

CP000959.PE104       Location/Qualifiers
FT   CDS_pept        118138..118485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3289"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B1787 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3289"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92445"
FT                   /db_xref="InterPro:IPR021947"
FT                   /db_xref="UniProtKB/TrEMBL:B1K8U8"
FT                   /protein_id="ACA92445.1"
FT                   /translation="MRLTIRINGSESATRHSFAVLWVDTDEGLWSREAHQGIDLPTWGK
FT                   IRDVEGAMALCAADSGNAVCQLKGLSFDAMRREQGPAVLAGEHPDGAWRLQAVDTCTTQ
FT                   PEYREFISVAR"
     atgcgcctca ccattcggat taatggcagc gaatcggcaa cccggcattc cttcgcggtc        60
     ttgtgggtcg ataccgacga agggctgtgg tcgcgcgagg cacatcaggg catcgacctt       120
     ccgacctggg gcaagatccg cgacgtcgaa ggcgcgatgg cgctgtgcgc ggccgacagc       180
     ggcaatgccg tctgtcagtt gaaggggctg tcgttcgatg cgatgcgccg cgaacagggc       240
     cccgcggtgc tcgccggcga gcaccccgac ggcgcgtggc gcctgcaggc ggtcgatacc       300
     tgcacgaccc agccggaata ccgggaattt atttccgttg cccgatag                    348
//

If you have problems or comments...

PBIL Back to PBIL home page