(data stored in ACNUC1104 zone)

EMBL: CP000959.PE106

CP000959.PE106       Location/Qualifiers
FT   CDS_pept        complement(120832..122547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3291"
FT                   /product="sodium/hydrogen exchanger"
FT                   /note="PFAM: TrkA-N domain protein; sodium/hydrogen
FT                   exchanger; KEGG: bur:Bcep18194_B1791 TrkA-N family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3291"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92447"
FT                   /db_xref="GOA:B1K8V0"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:B1K8V0"
FT                   /protein_id="ACA92447.1"
FT                   /translation="MPHDVSLIALLAAGFGLAMIFGYLASLLKMPPLVGYLLAGIVIGP
FT                   GTPGFVGDLSLAQQLAEVGVMLLMFGVGLHFSLGDLLAVRKIALPGAIVQITVATLLGG
FT                   GLALTWGWSLGAALVFGLALSVASTVVLLRALEGRGLVETVNGRIAVGWLVVEDLVMVL
FT                   VLVLLPPVAGLLGGTPPGDTHAAGGSVWGTLGVTMLKVAAFIALMLVVGKRVFPRILWL
FT                   VARTGSRELFTLCMIAAAVGIAFGAAKLFDVSFALGAFFAGMMMRESEFSRRAADETLP
FT                   LRDAFSVLFFISVGMLFDPKVLLDEPLHVIEVAAIVLIGKTVAAVALVIAFRYPLNTAL
FT                   TVGAGLAQIGEFSFILAGLGRALGLLSAEGQSLILAVALISIAMNTLLFAMIDPALAWI
FT                   RKHSAFARKLEARDDPLAALPMSTPQTHLTGQVVIVGYGKVGTRIAHALDERGIAYVVV
FT                   EQNRELVEKLRADGIAAVSGDAIEPIVLVQAHIARAGMLVVTLPDVFDVRQIVEISRTL
FT                   NPALEVVLCTNSGDEAALLSSEGIGTVFMGETELARGMTEHVLGRMAKPVAAAH"
     atgcctcatg acgtcagcct gattgcgttg ctcgcggccg gtttcggtct cgcgatgatc        60
     tttggttacc tcgcgtcgct gctgaaaatg ccgccgctcg tcggctatct gctcgccggg       120
     atcgtgatcg gccccggcac gcccggtttc gtcggcgacc tgtcgctcgc gcagcagctt       180
     gcggaagtcg gcgtgatgct gctgatgttc ggcgtcggcc tgcatttctc gctcggcgat       240
     ctcctcgcgg tgcgcaagat cgcgctgccg ggcgccatcg tccagatcac cgtcgcgacg       300
     ctgctcggcg gcgggctcgc gctcacgtgg ggctggagcc tcggtgcggc gctcgtgttc       360
     gggctggcgc tgtcggtcgc gagtaccgtc gtgctgctgc gcgcgctcga agggcgcggg       420
     ctcgtcgaga cggtcaacgg gcgcatcgcg gtgggctggc tggtcgtcga ggatctcgtg       480
     atggtgctcg tgctggtgct gctcccgccg gtggccgggc tgctcggcgg cacgccgccc       540
     ggcgatacgc atgcggccgg cggcagcgtg tggggcacgc tcggcgtcac gatgctgaag       600
     gtcgccgcat tcattgcact gatgctggtg gtcggcaagc gcgtgttccc gcgcattctg       660
     tggctcgtcg cgcgcaccgg ctcgcgcgag ctgttcacgc tgtgcatgat cgcggccgcg       720
     gtcggcatcg cgttcggcgc ggcgaagctg ttcgacgtgt cgttcgcgct cggcgcgttc       780
     ttcgccggga tgatgatgcg cgagtcggaa ttcagccggc gcgcggccga cgagacgctg       840
     ccgctgcgcg acgcgttctc ggtgctgttc ttcatctcgg tcggcatgct gttcgacccg       900
     aaggtgctgc tcgacgagcc gctgcacgtg atcgaggtcg cggccatcgt gctgatcggc       960
     aagacggtcg cggccgtcgc gctcgtgatc gcgttccgct atccgctaaa caccgcgttg      1020
     acggtcggcg cgggcctcgc gcagatcggc gaattctcgt tcatcctcgc ggggctcggc      1080
     cgtgcgctcg ggctgctgtc ggccgaaggg cagagcctga ttctcgcggt cgcgctgatc      1140
     tcgatcgcga tgaacacgct gctgttcgcg atgatcgatc cggcgctcgc gtggattcgc      1200
     aagcattcgg cgttcgcgcg caagctcgag gcgcgcgacg atccgctcgc cgcgctgccg      1260
     atgtcgacgc cgcagacgca tctgaccggg caggtcgtga tcgtcggcta cggcaaggtc      1320
     ggcacgcgaa tcgcgcatgc actggacgag cgcgggatcg cgtatgtcgt cgtcgagcag      1380
     aatcgcgagc tcgtcgagaa gctgcgtgcg gacggcatcg cggccgtgtc gggcgacgcg      1440
     atcgagccga tcgtgctcgt gcaggcgcat atcgcccgcg ccgggatgct ggtcgtcacg      1500
     ctgcccgacg tgttcgacgt gcggcagatc gtcgagatct cgcgcacgct caacccggcg      1560
     ctcgaggtcg tgctgtgcac gaacagcggt gacgaggccg cgctgctgtc gagcgagggc      1620
     atcggcaccg tgttcatggg cgagaccgaa ctcgcgcgcg ggatgaccga gcacgtgctc      1680
     ggccggatgg cgaagccggt cgcggccgcg cattga                                1716
//

If you have problems or comments...

PBIL Back to PBIL home page