(data stored in ACNUC1104 zone)

EMBL: CP000959.PE110

CP000959.PE110       Location/Qualifiers
FT   CDS_pept        complement(127438..127854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3296"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B1796 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3296"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92451"
FT                   /db_xref="GOA:B1K8V4"
FT                   /db_xref="InterPro:IPR025058"
FT                   /db_xref="UniProtKB/TrEMBL:B1K8V4"
FT                   /protein_id="ACA92451.1"
FT                   /translation="MTGAYFSVPTLCAIALVHVYWAFGGRLGKRAAIPEQDGVPLLRPT
FT                   AVGTLTVALALLGGAGVVAARAGWLGRNAYPCTIAFAVVALALIFAVRAVGDFRYVGFF
FT                   KRIRGSRFARMDTLYYSPLCAALALSIASMFWPW"
     atgaccggtg cgtatttcag cgtgccgacg ctttgcgcca tcgcgctcgt gcacgtctac        60
     tgggcgttcg gcgggcgatt gggcaagcgc gcggccattc cggagcagga tggcgtaccg       120
     ctgttgcggc cgacggcggt cggcacgctg accgtcgcgc tcgcgctgct gggcggggca       180
     ggcgtggtcg ccgcgcgtgc cggctggctg gggcgcaacg cgtatccctg cacgatcgcg       240
     ttcgcggtcg ttgcgctcgc attgatcttc gcggtgcgcg ccgtcggcga ttttcgctac       300
     gtcggcttct tcaaacggat tcgcgggtcg cgtttcgcgc ggatggacac gctgtattac       360
     tcgccgctgt gtgcggcgct ggcgctgtcg atcgcatcga tgttctggcc gtggtga          417
//

If you have problems or comments...

PBIL Back to PBIL home page