(data stored in ACNUC1104 zone)

EMBL: CP000959.PE111

CP000959.PE111       Location/Qualifiers
FT   CDS_pept        128151..129266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3297"
FT                   /product="alanine dehydrogenase"
FT                   /note="TIGRFAM: alanine dehydrogenase; PFAM: alanine
FT                   dehydrogenase/PNT domain protein; KEGG: bur:Bcep18194_B1797
FT                   alanine dehydrogenase and pyridine nucleotide
FT                   transhydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3297"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92452"
FT                   /db_xref="GOA:B1K8V5"
FT                   /db_xref="InterPro:IPR007698"
FT                   /db_xref="InterPro:IPR007886"
FT                   /db_xref="InterPro:IPR008141"
FT                   /db_xref="InterPro:IPR008143"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B1K8V5"
FT                   /protein_id="ACA92452.1"
FT                   /translation="MLIGVPKEIKNHEYRVGLTPAGARELTRHGHRVLVQRGAGTAIGL
FT                   LDDDYTAAGASLGDGAEEIFARADMIIKVKEPQPTECAMLRRGQILYTYLHLAPDPDQA
FT                   AALVKSGAVCIAYETVTGPGGGLPLLAPMSEVAGRMSIQVAATHLESPRGGRGLLMAGV
FT                   PGVPAAHVVVLGAGVVGTGALQMAVGLGARVTVLDNNVNRLRQLDLVFANRIATVCSNA
FT                   QTVDEAVRDADVVIGAVLVPGASAPRLVTRDMIATMRKGAVVVDVAIDQGGCFETSHAT
FT                   THAAPTFVVDGVVHYCVANMPGAVARTSTFALNNATLGHALALADKGWKQAMLDDPHLR
FT                   AGLNVCDGHITYEAVALALGLPYVPATGVLA"
     atgctgatcg gtgtgccgaa ggagatcaag aaccacgaat accgcgtcgg cctcacgccg        60
     gccggcgcgc gcgaactcac gcggcacggc catcgcgtgc tggtgcagcg cggcgcgggc       120
     accgcgatcg gcctgctcga cgacgactac acggccgcgg gcgcgtcgct cggcgacggc       180
     gccgaagaaa tcttcgcgcg cgccgacatg atcatcaagg tcaaggaacc gcagcccacc       240
     gaatgcgcga tgctgcggcg cggccagatc ctctacacgt acctgcatct cgcgcccgat       300
     cccgaccagg ccgccgcgct cgtgaaatcc ggcgcggtct gcatcgcgta cgaaaccgtg       360
     acgggccccg gcggcggcct gccgttgctc gcgccgatga gcgaagtcgc cggccgtatg       420
     tcgatccagg tcgcggcgac ccacctcgaa agcccgcgcg gcggccgcgg cctgctgatg       480
     gccggcgtgc cgggcgtgcc ggccgcgcac gtcgtcgtgc tcggcgcggg cgtcgtgggc       540
     accggtgcgc tgcagatggc ggtgggcctc ggcgcgcgcg tcaccgtgct cgacaacaac       600
     gtgaaccggt tgcgccagct cgatctcgtg ttcgccaacc ggatcgcgac cgtctgctcg       660
     aatgcgcaga cggtcgacga agccgtgcgc gatgccgacg tcgtgatcgg cgccgtgctc       720
     gttccgggcg catcggcgcc gcggctcgtc acgcgcgaca tgatcgcgac gatgcgcaag       780
     ggagcggtcg tcgtcgatgt cgcgatcgac cagggcggct gcttcgagac ctcgcatgcg       840
     accacgcacg cggcgccgac gttcgtggtc gacggagtgg tccactattg cgtcgcgaac       900
     atgcccggcg cggtcgcgcg cacgtcgacc tttgcgctga acaatgcaac gctcggccat       960
     gcgctcgcgc tcgccgacaa gggctggaag caggcgatgc tcgacgatcc gcatctgcgc      1020
     gcgggcctga acgtgtgcga cggccacatc acgtacgaag cggtcgcgct ggcgctcggc      1080
     ctgccctacg tcccggcgac cggcgtactc gcatga                                1116
//

If you have problems or comments...

PBIL Back to PBIL home page