(data stored in ACNUC1104 zone)

EMBL: CP000959.PE120

CP000959.PE120       Location/Qualifiers
FT   CDS_pept        138505..139560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3306"
FT                   /product="Domain of unknown function DUF1839"
FT                   /note="PFAM: Domain of unknown function DUF1839; KEGG:
FT                   bur:Bcep18194_B1807 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3306"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92461"
FT                   /db_xref="InterPro:IPR014989"
FT                   /db_xref="UniProtKB/TrEMBL:B1K996"
FT                   /protein_id="ACA92461.1"
FT                   /translation="MRFVSRDGEDASFESVRHRARHYRPHPLHSQEMVWKQTNCYVDMW
FT                   LEVLRWWGLNPYAALPFTIALDFEGDQFTFFKFPHDELERLYGIVVQEHSIYEPLDQHI
FT                   ETQVARGHLMIVEVDAWFLPDTRGSSYRTQHTKTTIGIDAIDRAKHQIGYFHNSGYYVA
FT                   EDFDYNGLVGGSSPMTLPPYVECAKRRFAPLDERALCEASLAALQRHLRRLPVVDPIAA
FT                   FRRQLQADAPILAEAPLEHFHAYSFNSVRQLGANFELFGHYARWLQASGCTGPFAEIRA
FT                   ACDRIASEAMVLEFRLARACARGKEERGDSTLEAIETAYGDLVACARQIGAPLRHVTPV
FT                   RYDTEPVSAMR"
     atgaggttcg tttcccgcga cggcgaagac gcgtcgttcg agagcgtgcg ccaccgcgcg        60
     cgccactacc ggccgcaccc gctgcacagt caggagatgg tctggaaaca gaccaactgc       120
     tacgtcgaca tgtggctcga ggtgctccgg tggtggggcc tcaatccgta cgcggcgctg       180
     ccgtttacga tcgcgctcga tttcgagggc gaccagttca cgttcttcaa gtttccgcac       240
     gacgagctgg agcggctcta cgggatcgtc gtgcaggaac attcgatcta cgagccgctc       300
     gaccagcaca tcgagacgca ggtcgcacgc ggccacctga tgatcgtcga ggtcgatgcg       360
     tggttcctgc ccgatacgcg cggcagcagc taccgcaccc agcacacgaa gacgacgatc       420
     ggcatcgacg cgatcgaccg cgcgaagcac cagatcggct acttccacaa cagcggctat       480
     tacgtcgccg aggatttcga ctacaacggg ctcgtcggcg gcagttcgcc gatgacgctg       540
     ccgccgtacg tcgaatgcgc gaagcgacgc tttgcgccgc tcgacgagcg cgcgctctgc       600
     gaagcgtcgc tcgccgcgtt gcagcgccac ctgcggcgcc tgccggtcgt cgatccgatc       660
     gcggcgttcc gtcggcagtt gcaggccgac gcgcccatcc tcgcggaggc gccgctcgag       720
     cacttccatg cgtattcgtt caattcggtg cgtcagctcg gcgcgaattt cgaactgttc       780
     ggccactatg cgcgctggct gcaggcgagc ggctgcaccg ggccgttcgc cgagatccgc       840
     gccgcgtgcg atcgcatcgc gtcggaggcg atggtgctcg aattccggct cgcgcgcgcg       900
     tgcgcacgcg gcaaggaaga acgcggcgat tcgacgctcg aagcgatcga gaccgcgtac       960
     ggcgacctcg tcgcgtgcgc gcggcagatc ggtgcgccgc tgcggcacgt gacgcccgtg      1020
     cgctacgaca cggagcccgt gtcggccatg cggtga                                1056
//

If you have problems or comments...

PBIL Back to PBIL home page